SlideShare ist ein Scribd-Unternehmen logo
1 von 63
Downloaden Sie, um offline zu lesen
e‐Human Beings:
The contribution of internet ranking 
systems to the development of 
human capital
Barry Smith
http://ontology.buffalo.edu/smith
Rate‐my‐professor
surely '
Simple on‐line rating systems improve 
our lives
A taxi‐summoning app
Uber allows customers to rate drivers
• for punctuality, cleanliness, and so forth. You 
can then ues these ratings in making bookings 
in the future. 
But then, when the leave the taxi, the drivers 
rate the customers, and these ratings too are 
stored in the system
Behind the scenes, good behavior is 
being rewarded and bad behavior 
punished
customers who vomit in the cab, or who refuse 
to pay, or who behave aggressively will find 
themselves restricted in their use of Uber in the 
future
e‐people
A new theory of personal identity:
You are a biological organism (with plans, skills, 
qualifications, titles, etc.) together with a 
reputational trail
– increasingly, your reputational trail is a 
matter of your rankings on internet ranking sites
– including more or less secret rankings on 
cites such as Uber, match.com, and SCHUFA
For academics, today, the most important 
ranking site is google scholar
New Possibilities for 
Scholarly Research
24
Jürgen Habermas
Saul Kripke
Jerry Fodor
Hilary Putnam
http://ngrams.googlelabs.com/graph?content=ontolo
gy,metaphysics&year_start=1700&year_end=2008
New Possibilities for 
Biological Research 
38
MKVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSFYEDEKSGLIKVV
KFRTGAMDRKRSFEKVVISVMVGKNVKKFLTFVEDEPDFQGGPISKYLIPKKINLM
VYTLFQVHTLKFNRKDYDTLSLFYLNRGYYNELSFRVLERCHEIASARPNDSSTMRT
FTDFVSGAPIVRSLQKSTIRKYGYNLAPYMFLLLHVDELSIFSAYQASLPGEKKVDTER
LKRDLCPRKPIEIKYFSQICNDMMNKKDRLGDILHIILRACALNFGAGPRGGAGDEE
DRSITNEEPIIPSVDEHGLKVCKLRSPNTPRRLRKTLDAVKALLVSSCACTARDLDIFD
DNNGVAMWKWIKILYHEVAQETTLKDSYRITLVPSSDGISLLAFAGPQRNVYVDDT
TRRIQLYTDYNKNGSSEPRLKTLDGLTSDYVFYFVTVLRQMQICALGNSYDAFNHD
PWMDVVGFEDPNQVTNRDISRIVLYSYMFLNTAKGCLVEYATFRQYMRELPKNAP
QKLNFREMRQGLIALGRHCVGSRFETDLYESATSELMANHSVQTGRNIYGVDFSLT
SVSGTTATLLQERASERWIQWLGLESDYHCSFSSTRNAEDVDISRIVLYSYMFLNTAK
GCLVEYATFRQYMRELPKNAPQKLNFREMRQGLIALGRHCVGSRFETDLYESATSEL
MANHSVQTGRNIYGVDFSLTSVSGTTATLLQERASERWIQWLGLESDYHCSFSSTR
NAEDV
New biology data
39
Old biology data
40/
The Gene Ontology
response to the massive opportunities 
created by the success of the Human 
Genome Project
for cross‐organism biology
for intra‐organism biology
for the biology of environments
41
You’re interested
in which genes
control heart
muscle
development
17,536 results
42
43
Definitions
44
Gene products involved in cardiac muscle development in humans45
47
Google hits Jan. 2004
ontology + Heidegger 58K
ontology + Aristotle 77K
ontology + philosophy 327K
ontology + software 468K
ontology + database 594K
ontology + information systems 702K
48
Comparison 2004/2012
ontology + Heidegger 58K 1.91M
ontology + Aristotle 77K 1.66M
ontology + philosophy 327K 4.91M
ontology + software 468K 7.80M
ontology + database 594K 10.20M
ontology +information systems 702K 5.14M
how deal with oral cultures?
can be applied to mathematics too
how does the state planning budget 
get put together?
pol pot destroyed documents –
consequences still with us
49
New Possibilities for 
Massively Planned 
Social Action
50
Eric Whitacre’s Virtual Choir
Lux Aurumque (2010)
185 voices, 12 countries
51
Lux Aurumque
http://www.youtube.com/watch?v=D7o7BrlbaDs
• Eric Whitacre’s Virtual Choir 3.0, 3746 vidoes from 78 
countries
53
The meshing of actions of over 3000 
people in 78 different countries
• most of whom will never communicate with 
each other
54
55
56
US military operations center in Afghanistan
57
Warfighters’ Information Sharing Environment
Fire
Support
LogisticsAir Operations
Intelligence
Civil-Military
Operations
Targeting
Maneuver
&
Blue
Force
Tracking
e‐people (biology + Bildungskapital + 
intermeshing)
A new theory of personal identity:
You are a biological organism, with plans, skills, and a reputational trail
that is intermeshed digitally with the plans, skills and reputational trails 
of other human beings 
in such a way as to enable new sorts of human achievements in 
science, culture, commerce, law, war, …
Hernando de Soto
Institute for Liberty and Democracy, Lima, Peru
Bill Clinton: 
“The most promising anti‐poverty initiative in the world”
60
61
de Soto’s hypothesis
the development of civilization in the course 
of history goes hand in hand with the 
accumulation of documentation 
(property titles, registration of persons, 
professional qualifications, keeping of 
accounts ...)
62
The need for a trace
Civilization rests on complex social entities – claims, 
obligations, rights, powers, roles, offices
which survive for an extended period of time
What is the physical basis for this extended existence? 
Not the memories of those involved
–but permanent, re‐usable, discoverable records
These systems of records allowed new institutional 
artefacts such as mortgages and insurance to be 
created
and allowed human beings to acquire the habits and 
skills needed to participate successfully in the 
extended market order

Weitere ähnliche Inhalte

Ähnlich wie e‐Human Beings: The contribution of internet ranking systems to the development of human capital

Fuzzy Logic Based Recommender System
Fuzzy Logic Based Recommender SystemFuzzy Logic Based Recommender System
Fuzzy Logic Based Recommender SystemRSIS International
 
Overview of Recruitment Management Systems- Business.com
Overview of Recruitment Management Systems- Business.comOverview of Recruitment Management Systems- Business.com
Overview of Recruitment Management Systems- Business.comBusiness.com
 
AI Governance – The Responsible Use of AI
AI Governance – The Responsible Use of AIAI Governance – The Responsible Use of AI
AI Governance – The Responsible Use of AINUS-ISS
 
Faces in the Distorting Mirror: Revisiting Photo-based Social Authentication
Faces in the Distorting Mirror: Revisiting Photo-based Social AuthenticationFaces in the Distorting Mirror: Revisiting Photo-based Social Authentication
Faces in the Distorting Mirror: Revisiting Photo-based Social AuthenticationFACE
 
recruitment and selection in internet context.pdf
recruitment and selection in internet context.pdfrecruitment and selection in internet context.pdf
recruitment and selection in internet context.pdfshazia-ijaz
 
IRJET- Improving Performance of Fake Reviews Detection in Online Review’s usi...
IRJET- Improving Performance of Fake Reviews Detection in Online Review’s usi...IRJET- Improving Performance of Fake Reviews Detection in Online Review’s usi...
IRJET- Improving Performance of Fake Reviews Detection in Online Review’s usi...IRJET Journal
 
TRAIL Deck
TRAIL DeckTRAIL Deck
TRAIL DeckTRAIL
 
Recommendation Engines - An Architectural Guide
Recommendation Engines - An Architectural GuideRecommendation Engines - An Architectural Guide
Recommendation Engines - An Architectural GuideBigDataCloud
 
Unc cause 2010 Identity and Access Mgmt Panel
Unc cause 2010  Identity and Access Mgmt PanelUnc cause 2010  Identity and Access Mgmt Panel
Unc cause 2010 Identity and Access Mgmt PanelMark Scheible
 
Social Tagging Of Multimedia Content A Model
Social Tagging Of Multimedia Content A ModelSocial Tagging Of Multimedia Content A Model
Social Tagging Of Multimedia Content A ModelIJMER
 
3 Rules Behind The Most Successful Products - SC Moatti, Mighty Capital
3 Rules Behind The Most Successful Products - SC Moatti, Mighty Capital3 Rules Behind The Most Successful Products - SC Moatti, Mighty Capital
3 Rules Behind The Most Successful Products - SC Moatti, Mighty CapitalTraction Conf
 
"The 3 Rules Behind The Most Successful Products" by SC Moatti
"The 3 Rules Behind The Most Successful Products" by SC Moatti "The 3 Rules Behind The Most Successful Products" by SC Moatti
"The 3 Rules Behind The Most Successful Products" by SC Moatti Productized
 
12813 1 Copyright © 2011 Pearson Education, Inc. Al
12813 1 Copyright © 2011 Pearson Education, Inc.  Al12813 1 Copyright © 2011 Pearson Education, Inc.  Al
12813 1 Copyright © 2011 Pearson Education, Inc. Aldrennanmicah
 
12813 1 Copyright © 2011 Pearson Education, Inc. Al
12813 1 Copyright © 2011 Pearson Education, Inc.  Al12813 1 Copyright © 2011 Pearson Education, Inc.  Al
12813 1 Copyright © 2011 Pearson Education, Inc. Alalisondakintxt
 
12813 1 Copyright © 2011 Pearson Education, Inc. Al
12813 1 Copyright © 2011 Pearson Education, Inc.  Al12813 1 Copyright © 2011 Pearson Education, Inc.  Al
12813 1 Copyright © 2011 Pearson Education, Inc. Allauvicuna8dw
 
An Integrated E-Recruitment System For Automated Personality Mining And Appli...
An Integrated E-Recruitment System For Automated Personality Mining And Appli...An Integrated E-Recruitment System For Automated Personality Mining And Appli...
An Integrated E-Recruitment System For Automated Personality Mining And Appli...Fiona Phillips
 
Recommender System _Module 1_Introduction to Recommender System.pptx
Recommender System _Module 1_Introduction to Recommender System.pptxRecommender System _Module 1_Introduction to Recommender System.pptx
Recommender System _Module 1_Introduction to Recommender System.pptxSatyam Sharma
 
How Uber turbo-charged the Sharing Economy Business Model
How Uber turbo-charged the Sharing Economy Business ModelHow Uber turbo-charged the Sharing Economy Business Model
How Uber turbo-charged the Sharing Economy Business ModelMurat @ InnovationTactics.com
 

Ähnlich wie e‐Human Beings: The contribution of internet ranking systems to the development of human capital (20)

Fuzzy Logic Based Recommender System
Fuzzy Logic Based Recommender SystemFuzzy Logic Based Recommender System
Fuzzy Logic Based Recommender System
 
Overview of Recruitment Management Systems- Business.com
Overview of Recruitment Management Systems- Business.comOverview of Recruitment Management Systems- Business.com
Overview of Recruitment Management Systems- Business.com
 
AI Governance – The Responsible Use of AI
AI Governance – The Responsible Use of AIAI Governance – The Responsible Use of AI
AI Governance – The Responsible Use of AI
 
Faces in the Distorting Mirror: Revisiting Photo-based Social Authentication
Faces in the Distorting Mirror: Revisiting Photo-based Social AuthenticationFaces in the Distorting Mirror: Revisiting Photo-based Social Authentication
Faces in the Distorting Mirror: Revisiting Photo-based Social Authentication
 
recruitment and selection in internet context.pdf
recruitment and selection in internet context.pdfrecruitment and selection in internet context.pdf
recruitment and selection in internet context.pdf
 
IRJET- Improving Performance of Fake Reviews Detection in Online Review’s usi...
IRJET- Improving Performance of Fake Reviews Detection in Online Review’s usi...IRJET- Improving Performance of Fake Reviews Detection in Online Review’s usi...
IRJET- Improving Performance of Fake Reviews Detection in Online Review’s usi...
 
TRAIL Deck
TRAIL DeckTRAIL Deck
TRAIL Deck
 
Hris
HrisHris
Hris
 
Recommendation Engines - An Architectural Guide
Recommendation Engines - An Architectural GuideRecommendation Engines - An Architectural Guide
Recommendation Engines - An Architectural Guide
 
Unc cause 2010 Identity and Access Mgmt Panel
Unc cause 2010  Identity and Access Mgmt PanelUnc cause 2010  Identity and Access Mgmt Panel
Unc cause 2010 Identity and Access Mgmt Panel
 
Social Tagging Of Multimedia Content A Model
Social Tagging Of Multimedia Content A ModelSocial Tagging Of Multimedia Content A Model
Social Tagging Of Multimedia Content A Model
 
3 Rules Behind The Most Successful Products - SC Moatti, Mighty Capital
3 Rules Behind The Most Successful Products - SC Moatti, Mighty Capital3 Rules Behind The Most Successful Products - SC Moatti, Mighty Capital
3 Rules Behind The Most Successful Products - SC Moatti, Mighty Capital
 
"The 3 Rules Behind The Most Successful Products" by SC Moatti
"The 3 Rules Behind The Most Successful Products" by SC Moatti "The 3 Rules Behind The Most Successful Products" by SC Moatti
"The 3 Rules Behind The Most Successful Products" by SC Moatti
 
12813 1 Copyright © 2011 Pearson Education, Inc. Al
12813 1 Copyright © 2011 Pearson Education, Inc.  Al12813 1 Copyright © 2011 Pearson Education, Inc.  Al
12813 1 Copyright © 2011 Pearson Education, Inc. Al
 
12813 1 Copyright © 2011 Pearson Education, Inc. Al
12813 1 Copyright © 2011 Pearson Education, Inc.  Al12813 1 Copyright © 2011 Pearson Education, Inc.  Al
12813 1 Copyright © 2011 Pearson Education, Inc. Al
 
12813 1 Copyright © 2011 Pearson Education, Inc. Al
12813 1 Copyright © 2011 Pearson Education, Inc.  Al12813 1 Copyright © 2011 Pearson Education, Inc.  Al
12813 1 Copyright © 2011 Pearson Education, Inc. Al
 
An Integrated E-Recruitment System For Automated Personality Mining And Appli...
An Integrated E-Recruitment System For Automated Personality Mining And Appli...An Integrated E-Recruitment System For Automated Personality Mining And Appli...
An Integrated E-Recruitment System For Automated Personality Mining And Appli...
 
Recommender System _Module 1_Introduction to Recommender System.pptx
Recommender System _Module 1_Introduction to Recommender System.pptxRecommender System _Module 1_Introduction to Recommender System.pptx
Recommender System _Module 1_Introduction to Recommender System.pptx
 
Digital Ethics
Digital EthicsDigital Ethics
Digital Ethics
 
How Uber turbo-charged the Sharing Economy Business Model
How Uber turbo-charged the Sharing Economy Business ModelHow Uber turbo-charged the Sharing Economy Business Model
How Uber turbo-charged the Sharing Economy Business Model
 

Mehr von Barry Smith

Towards an Ontology of Philosophy
Towards an Ontology of PhilosophyTowards an Ontology of Philosophy
Towards an Ontology of PhilosophyBarry Smith
 
An application of Basic Formal Ontology to the Ontology of Services and Commo...
An application of Basic Formal Ontology to the Ontology of Services and Commo...An application of Basic Formal Ontology to the Ontology of Services and Commo...
An application of Basic Formal Ontology to the Ontology of Services and Commo...Barry Smith
 
Ways of Worldmarking: The Ontology of the Eruv
Ways of Worldmarking: The Ontology of the EruvWays of Worldmarking: The Ontology of the Eruv
Ways of Worldmarking: The Ontology of the EruvBarry Smith
 
The Division of Deontic Labor
The Division of Deontic LaborThe Division of Deontic Labor
The Division of Deontic LaborBarry Smith
 
Ontology of Aging (August 2014)
Ontology of Aging (August 2014)Ontology of Aging (August 2014)
Ontology of Aging (August 2014)Barry Smith
 
The Fifth Cycle of Philosophy
The Fifth Cycle of PhilosophyThe Fifth Cycle of Philosophy
The Fifth Cycle of PhilosophyBarry Smith
 
Ontology of Poker
Ontology of PokerOntology of Poker
Ontology of PokerBarry Smith
 
Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...
Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...
Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...Barry Smith
 
Enhancing the Quality of ImmPort Data
Enhancing the Quality of ImmPort DataEnhancing the Quality of ImmPort Data
Enhancing the Quality of ImmPort DataBarry Smith
 
The Philosophome: An Exercise in the Ontology of the Humanities
The Philosophome: An Exercise in the Ontology of the HumanitiesThe Philosophome: An Exercise in the Ontology of the Humanities
The Philosophome: An Exercise in the Ontology of the HumanitiesBarry Smith
 
IAO-Intel: An Ontology of Information Artifacts in the Intelligence Domain
IAO-Intel: An Ontology of Information Artifacts in the Intelligence DomainIAO-Intel: An Ontology of Information Artifacts in the Intelligence Domain
IAO-Intel: An Ontology of Information Artifacts in the Intelligence DomainBarry Smith
 
Science of Emerging Social Media
Science of Emerging Social MediaScience of Emerging Social Media
Science of Emerging Social MediaBarry Smith
 
Ethics, Informatics and Obamacare
Ethics, Informatics and ObamacareEthics, Informatics and Obamacare
Ethics, Informatics and ObamacareBarry Smith
 
Ontology of aging and death
Ontology of aging and deathOntology of aging and death
Ontology of aging and deathBarry Smith
 
Ontology in-buffalo-2013
Ontology in-buffalo-2013Ontology in-buffalo-2013
Ontology in-buffalo-2013Barry Smith
 
ImmPort strategies to enhance discoverability of clinical trial data
ImmPort strategies to enhance discoverability of clinical trial dataImmPort strategies to enhance discoverability of clinical trial data
ImmPort strategies to enhance discoverability of clinical trial dataBarry Smith
 
Ontology of Documents (2005)
Ontology of Documents (2005)Ontology of Documents (2005)
Ontology of Documents (2005)Barry Smith
 
Ontology and the National Cancer Institute Thesaurus (2005)
Ontology and the National Cancer Institute Thesaurus (2005)Ontology and the National Cancer Institute Thesaurus (2005)
Ontology and the National Cancer Institute Thesaurus (2005)Barry Smith
 
Introduction to the Logic of Definitions
Introduction to the Logic of DefinitionsIntroduction to the Logic of Definitions
Introduction to the Logic of DefinitionsBarry Smith
 

Mehr von Barry Smith (20)

Towards an Ontology of Philosophy
Towards an Ontology of PhilosophyTowards an Ontology of Philosophy
Towards an Ontology of Philosophy
 
An application of Basic Formal Ontology to the Ontology of Services and Commo...
An application of Basic Formal Ontology to the Ontology of Services and Commo...An application of Basic Formal Ontology to the Ontology of Services and Commo...
An application of Basic Formal Ontology to the Ontology of Services and Commo...
 
Ways of Worldmarking: The Ontology of the Eruv
Ways of Worldmarking: The Ontology of the EruvWays of Worldmarking: The Ontology of the Eruv
Ways of Worldmarking: The Ontology of the Eruv
 
The Division of Deontic Labor
The Division of Deontic LaborThe Division of Deontic Labor
The Division of Deontic Labor
 
Ontology of Aging (August 2014)
Ontology of Aging (August 2014)Ontology of Aging (August 2014)
Ontology of Aging (August 2014)
 
Meaningful Use
Meaningful UseMeaningful Use
Meaningful Use
 
The Fifth Cycle of Philosophy
The Fifth Cycle of PhilosophyThe Fifth Cycle of Philosophy
The Fifth Cycle of Philosophy
 
Ontology of Poker
Ontology of PokerOntology of Poker
Ontology of Poker
 
Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...
Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...
Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...
 
Enhancing the Quality of ImmPort Data
Enhancing the Quality of ImmPort DataEnhancing the Quality of ImmPort Data
Enhancing the Quality of ImmPort Data
 
The Philosophome: An Exercise in the Ontology of the Humanities
The Philosophome: An Exercise in the Ontology of the HumanitiesThe Philosophome: An Exercise in the Ontology of the Humanities
The Philosophome: An Exercise in the Ontology of the Humanities
 
IAO-Intel: An Ontology of Information Artifacts in the Intelligence Domain
IAO-Intel: An Ontology of Information Artifacts in the Intelligence DomainIAO-Intel: An Ontology of Information Artifacts in the Intelligence Domain
IAO-Intel: An Ontology of Information Artifacts in the Intelligence Domain
 
Science of Emerging Social Media
Science of Emerging Social MediaScience of Emerging Social Media
Science of Emerging Social Media
 
Ethics, Informatics and Obamacare
Ethics, Informatics and ObamacareEthics, Informatics and Obamacare
Ethics, Informatics and Obamacare
 
Ontology of aging and death
Ontology of aging and deathOntology of aging and death
Ontology of aging and death
 
Ontology in-buffalo-2013
Ontology in-buffalo-2013Ontology in-buffalo-2013
Ontology in-buffalo-2013
 
ImmPort strategies to enhance discoverability of clinical trial data
ImmPort strategies to enhance discoverability of clinical trial dataImmPort strategies to enhance discoverability of clinical trial data
ImmPort strategies to enhance discoverability of clinical trial data
 
Ontology of Documents (2005)
Ontology of Documents (2005)Ontology of Documents (2005)
Ontology of Documents (2005)
 
Ontology and the National Cancer Institute Thesaurus (2005)
Ontology and the National Cancer Institute Thesaurus (2005)Ontology and the National Cancer Institute Thesaurus (2005)
Ontology and the National Cancer Institute Thesaurus (2005)
 
Introduction to the Logic of Definitions
Introduction to the Logic of DefinitionsIntroduction to the Logic of Definitions
Introduction to the Logic of Definitions
 

Kürzlich hochgeladen

Unit-IV- Pharma. Marketing Channels.pptx
Unit-IV- Pharma. Marketing Channels.pptxUnit-IV- Pharma. Marketing Channels.pptx
Unit-IV- Pharma. Marketing Channels.pptxVishalSingh1417
 
fourth grading exam for kindergarten in writing
fourth grading exam for kindergarten in writingfourth grading exam for kindergarten in writing
fourth grading exam for kindergarten in writingTeacherCyreneCayanan
 
Accessible design: Minimum effort, maximum impact
Accessible design: Minimum effort, maximum impactAccessible design: Minimum effort, maximum impact
Accessible design: Minimum effort, maximum impactdawncurless
 
General AI for Medical Educators April 2024
General AI for Medical Educators April 2024General AI for Medical Educators April 2024
General AI for Medical Educators April 2024Janet Corral
 
1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 -  Danh muc Sach Giao Khoa 10 . pdf1029 -  Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdfQucHHunhnh
 
Interactive Powerpoint_How to Master effective communication
Interactive Powerpoint_How to Master effective communicationInteractive Powerpoint_How to Master effective communication
Interactive Powerpoint_How to Master effective communicationnomboosow
 
Sports & Fitness Value Added Course FY..
Sports & Fitness Value Added Course FY..Sports & Fitness Value Added Course FY..
Sports & Fitness Value Added Course FY..Disha Kariya
 
Arihant handbook biology for class 11 .pdf
Arihant handbook biology for class 11 .pdfArihant handbook biology for class 11 .pdf
Arihant handbook biology for class 11 .pdfchloefrazer622
 
Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...
Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...
Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...Krashi Coaching
 
SOCIAL AND HISTORICAL CONTEXT - LFTVD.pptx
SOCIAL AND HISTORICAL CONTEXT - LFTVD.pptxSOCIAL AND HISTORICAL CONTEXT - LFTVD.pptx
SOCIAL AND HISTORICAL CONTEXT - LFTVD.pptxiammrhaywood
 
Holdier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdfHoldier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdfagholdier
 
IGNOU MSCCFT and PGDCFT Exam Question Pattern: MCFT003 Counselling and Family...
IGNOU MSCCFT and PGDCFT Exam Question Pattern: MCFT003 Counselling and Family...IGNOU MSCCFT and PGDCFT Exam Question Pattern: MCFT003 Counselling and Family...
IGNOU MSCCFT and PGDCFT Exam Question Pattern: MCFT003 Counselling and Family...PsychoTech Services
 
Measures of Central Tendency: Mean, Median and Mode
Measures of Central Tendency: Mean, Median and ModeMeasures of Central Tendency: Mean, Median and Mode
Measures of Central Tendency: Mean, Median and ModeThiyagu K
 
microwave assisted reaction. General introduction
microwave assisted reaction. General introductionmicrowave assisted reaction. General introduction
microwave assisted reaction. General introductionMaksud Ahmed
 
Sanyam Choudhary Chemistry practical.pdf
Sanyam Choudhary Chemistry practical.pdfSanyam Choudhary Chemistry practical.pdf
Sanyam Choudhary Chemistry practical.pdfsanyamsingh5019
 
Activity 01 - Artificial Culture (1).pdf
Activity 01 - Artificial Culture (1).pdfActivity 01 - Artificial Culture (1).pdf
Activity 01 - Artificial Culture (1).pdfciinovamais
 
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in DelhiRussian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhikauryashika82
 
Disha NEET Physics Guide for classes 11 and 12.pdf
Disha NEET Physics Guide for classes 11 and 12.pdfDisha NEET Physics Guide for classes 11 and 12.pdf
Disha NEET Physics Guide for classes 11 and 12.pdfchloefrazer622
 

Kürzlich hochgeladen (20)

Unit-IV- Pharma. Marketing Channels.pptx
Unit-IV- Pharma. Marketing Channels.pptxUnit-IV- Pharma. Marketing Channels.pptx
Unit-IV- Pharma. Marketing Channels.pptx
 
Código Creativo y Arte de Software | Unidad 1
Código Creativo y Arte de Software | Unidad 1Código Creativo y Arte de Software | Unidad 1
Código Creativo y Arte de Software | Unidad 1
 
fourth grading exam for kindergarten in writing
fourth grading exam for kindergarten in writingfourth grading exam for kindergarten in writing
fourth grading exam for kindergarten in writing
 
Accessible design: Minimum effort, maximum impact
Accessible design: Minimum effort, maximum impactAccessible design: Minimum effort, maximum impact
Accessible design: Minimum effort, maximum impact
 
General AI for Medical Educators April 2024
General AI for Medical Educators April 2024General AI for Medical Educators April 2024
General AI for Medical Educators April 2024
 
1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 -  Danh muc Sach Giao Khoa 10 . pdf1029 -  Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdf
 
Interactive Powerpoint_How to Master effective communication
Interactive Powerpoint_How to Master effective communicationInteractive Powerpoint_How to Master effective communication
Interactive Powerpoint_How to Master effective communication
 
Sports & Fitness Value Added Course FY..
Sports & Fitness Value Added Course FY..Sports & Fitness Value Added Course FY..
Sports & Fitness Value Added Course FY..
 
Arihant handbook biology for class 11 .pdf
Arihant handbook biology for class 11 .pdfArihant handbook biology for class 11 .pdf
Arihant handbook biology for class 11 .pdf
 
Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...
Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...
Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...
 
SOCIAL AND HISTORICAL CONTEXT - LFTVD.pptx
SOCIAL AND HISTORICAL CONTEXT - LFTVD.pptxSOCIAL AND HISTORICAL CONTEXT - LFTVD.pptx
SOCIAL AND HISTORICAL CONTEXT - LFTVD.pptx
 
Advance Mobile Application Development class 07
Advance Mobile Application Development class 07Advance Mobile Application Development class 07
Advance Mobile Application Development class 07
 
Holdier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdfHoldier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdf
 
IGNOU MSCCFT and PGDCFT Exam Question Pattern: MCFT003 Counselling and Family...
IGNOU MSCCFT and PGDCFT Exam Question Pattern: MCFT003 Counselling and Family...IGNOU MSCCFT and PGDCFT Exam Question Pattern: MCFT003 Counselling and Family...
IGNOU MSCCFT and PGDCFT Exam Question Pattern: MCFT003 Counselling and Family...
 
Measures of Central Tendency: Mean, Median and Mode
Measures of Central Tendency: Mean, Median and ModeMeasures of Central Tendency: Mean, Median and Mode
Measures of Central Tendency: Mean, Median and Mode
 
microwave assisted reaction. General introduction
microwave assisted reaction. General introductionmicrowave assisted reaction. General introduction
microwave assisted reaction. General introduction
 
Sanyam Choudhary Chemistry practical.pdf
Sanyam Choudhary Chemistry practical.pdfSanyam Choudhary Chemistry practical.pdf
Sanyam Choudhary Chemistry practical.pdf
 
Activity 01 - Artificial Culture (1).pdf
Activity 01 - Artificial Culture (1).pdfActivity 01 - Artificial Culture (1).pdf
Activity 01 - Artificial Culture (1).pdf
 
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in DelhiRussian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
 
Disha NEET Physics Guide for classes 11 and 12.pdf
Disha NEET Physics Guide for classes 11 and 12.pdfDisha NEET Physics Guide for classes 11 and 12.pdf
Disha NEET Physics Guide for classes 11 and 12.pdf
 

e‐Human Beings: The contribution of internet ranking systems to the development of human capital