SlideShare ist ein Scribd-Unternehmen logo
1 von 26
Society of St. Andrew
gleaning america’s fields,
feeding america’s hungry

Why is so much good food
available to glean and distribute to
the hungry?

Take our quiz to see if you
know why!
These beans are headed
for a landfill. What’s
wrong with them?
A. They are not fresh.

B. Nobody likes green beans.
C. They are the wrong length.
D. They have botulism spores.
A. They are not fresh.

B. Nobody likes green beans.
C. They are the wrong length.
D. They have botulism spores.
These strawberries are
headed for a landfill.
What’s wrong with them?
A. Strawberries are too messy.

B. They have an insect problem.
C. Somebody dropped them.
D. The farm closed for the season.
A. Strawberries are too messy.

B. They have an insect problem.
C. Somebody dropped them.
D. The farm closed for the season.
These potatoes are headed
for a landfill. What’s
wrong with them?
A. They are moldy.

B. They have blemishes.
C. Bird’s Eye changed packaging.
D. People prefer 5-lb bags.
A. They are moldy.

B. They have blemishes.
C. Bird’s Eye changed packaging.
D. People prefer 5-lb bags.
These potatoes are headed
for a landfill. What’s
wrong with them?
A. They were delivered to the
wrong place.
B. The flavor is off.

C. They are last year’s potatoes.
D. They are the wrong shape.
A. They were delivered to the
wrong place.
B. The flavor is off.

C. They are last year’s potatoes.
D. They are the wrong shape.
This corn is headed for a
landfill. What’s
wrong with it?
A. They were the second and third
ears on each stalk.
B. They have pesticide residue.

C. The ears are wormy.
D. They fell off the truck.
A. They were the second and third
ears on each stalk.
B. They have pesticide residue.

C. The ears are wormy.
D. They fell off the truck.
These tomatoes are headed
for a landfill. What’s
wrong with them?
A. They weren’t refrigerated.

B. They are misshapen.
C. They are too ripe.
D. They are squished.
A. They weren’t refrigerated.

B. They are misshapen.
C. They are too ripe.
D. They are squished.
These peaches are headed
for a landfill. What’s
wrong with them?
A. They were overlooked at
harvest.
B. They are bruised.

C. They didn’t get sold.
D. They are too big.
A. They were overlooked at
harvest.
B. They are bruised.

C. They didn’t get sold.
D. They are too big.
Meanwhile,
50 million Americans
struggle to put food on
their tables.
In 2012, with the help of
40,300 volunteers
the Society of St. Andrew put
100 million servings
of fresh fruits and vegetables on
the tables of people at risk
for hunger across the US
Society of St. Andrew
3383 Sweet Hollow Road
Big Island, VA 24526

800-333-4597
Look for us on Facebook & Twitter!

ENDhunger.org

Weitere ähnliche Inhalte

Was ist angesagt?

Was ist angesagt? (17)

Mother Nature Festival
Mother Nature FestivalMother Nature Festival
Mother Nature Festival
 
Boulevard Food Co-Op
Boulevard Food Co-OpBoulevard Food Co-Op
Boulevard Food Co-Op
 
How Much Water (And Money) Does a Leaky Faucet Waste?
How Much Water (And Money) Does a Leaky Faucet Waste?How Much Water (And Money) Does a Leaky Faucet Waste?
How Much Water (And Money) Does a Leaky Faucet Waste?
 
Week 7 CH Presentation
Week 7 CH PresentationWeek 7 CH Presentation
Week 7 CH Presentation
 
Owl_Poster_2016-3
Owl_Poster_2016-3Owl_Poster_2016-3
Owl_Poster_2016-3
 
2014 Conference - Gretchen LeBuhn from SF State
2014 Conference - Gretchen LeBuhn from SF State2014 Conference - Gretchen LeBuhn from SF State
2014 Conference - Gretchen LeBuhn from SF State
 
JMCAP Thanksgiving Event 2015
JMCAP Thanksgiving Event 2015JMCAP Thanksgiving Event 2015
JMCAP Thanksgiving Event 2015
 
Virginia Farm-to-School Week: Growing from the Grassroots
Virginia Farm-to-School Week: Growing from the GrassrootsVirginia Farm-to-School Week: Growing from the Grassroots
Virginia Farm-to-School Week: Growing from the Grassroots
 
To B or Not To B
To B or Not To BTo B or Not To B
To B or Not To B
 
What is DC Local Flavor Week?
What is DC Local Flavor Week?What is DC Local Flavor Week?
What is DC Local Flavor Week?
 
Oxfam Launches East Africa Appeal for Starving People
Oxfam Launches East Africa Appeal for Starving PeopleOxfam Launches East Africa Appeal for Starving People
Oxfam Launches East Africa Appeal for Starving People
 
5,525 Cig. Butts
5,525 Cig. Butts5,525 Cig. Butts
5,525 Cig. Butts
 
Excellent Conference Summary from a Participant
Excellent Conference Summary from a ParticipantExcellent Conference Summary from a Participant
Excellent Conference Summary from a Participant
 
Wwd presentation
Wwd presentationWwd presentation
Wwd presentation
 
Wwd presentation
Wwd presentationWwd presentation
Wwd presentation
 
Books and events
Books and eventsBooks and events
Books and events
 
Compassion Sunday 2017 - Calvary Syracuse
Compassion Sunday 2017 - Calvary SyracuseCompassion Sunday 2017 - Calvary Syracuse
Compassion Sunday 2017 - Calvary Syracuse
 

Andere mochten auch

Quantitative Questionnaire
Quantitative QuestionnaireQuantitative Questionnaire
Quantitative Questionnairesaujanya94
 
Be Part of the Party to Celebrate the International Year of Pulses: Dry Beans...
Be Part of the Party to Celebrate the International Year of Pulses: Dry Beans...Be Part of the Party to Celebrate the International Year of Pulses: Dry Beans...
Be Part of the Party to Celebrate the International Year of Pulses: Dry Beans...Alice Henneman
 
BASIC INFO ON FUDUS FLORESCENCE ANGIOGRAPHY
BASIC INFO ON FUDUS FLORESCENCE ANGIOGRAPHYBASIC INFO ON FUDUS FLORESCENCE ANGIOGRAPHY
BASIC INFO ON FUDUS FLORESCENCE ANGIOGRAPHYNalin Nayan
 
fundus flourescien angiography
fundus flourescien angiographyfundus flourescien angiography
fundus flourescien angiographyVASIUR RAHMAN
 
Fundus Fluorescein Angiography
   Fundus Fluorescein Angiography   Fundus Fluorescein Angiography
Fundus Fluorescein Angiographykopila kafle
 
Fluorescein in Ophthalmology
Fluorescein in OphthalmologyFluorescein in Ophthalmology
Fluorescein in OphthalmologySamuel Ponraj
 
Air pollution: its causes,effects and pollutants
Air pollution: its causes,effects and pollutantsAir pollution: its causes,effects and pollutants
Air pollution: its causes,effects and pollutantsMaliha Eesha
 

Andere mochten auch (11)

التقديم و التأخير
التقديم و التأخيرالتقديم و التأخير
التقديم و التأخير
 
Wasted food-ip usa 2012
Wasted food-ip usa  2012Wasted food-ip usa  2012
Wasted food-ip usa 2012
 
Quantitative Questionnaire
Quantitative QuestionnaireQuantitative Questionnaire
Quantitative Questionnaire
 
Fundus Fluorescein Angiography
Fundus  Fluorescein AngiographyFundus  Fluorescein Angiography
Fundus Fluorescein Angiography
 
Be Part of the Party to Celebrate the International Year of Pulses: Dry Beans...
Be Part of the Party to Celebrate the International Year of Pulses: Dry Beans...Be Part of the Party to Celebrate the International Year of Pulses: Dry Beans...
Be Part of the Party to Celebrate the International Year of Pulses: Dry Beans...
 
BASIC INFO ON FUDUS FLORESCENCE ANGIOGRAPHY
BASIC INFO ON FUDUS FLORESCENCE ANGIOGRAPHYBASIC INFO ON FUDUS FLORESCENCE ANGIOGRAPHY
BASIC INFO ON FUDUS FLORESCENCE ANGIOGRAPHY
 
fundus flourescien angiography
fundus flourescien angiographyfundus flourescien angiography
fundus flourescien angiography
 
Fundus Fluorescein Angiography
   Fundus Fluorescein Angiography   Fundus Fluorescein Angiography
Fundus Fluorescein Angiography
 
Fluorescein in Ophthalmology
Fluorescein in OphthalmologyFluorescein in Ophthalmology
Fluorescein in Ophthalmology
 
Air pollution: its causes,effects and pollutants
Air pollution: its causes,effects and pollutantsAir pollution: its causes,effects and pollutants
Air pollution: its causes,effects and pollutants
 
Air pollution final.ppt
Air pollution final.pptAir pollution final.ppt
Air pollution final.ppt
 

Ähnlich wie Ppt for ffa

pronoun -----agreement for primary s.ppt
pronoun -----agreement for primary s.pptpronoun -----agreement for primary s.ppt
pronoun -----agreement for primary s.pptFghhGhjkl
 
Phil iri english 6
Phil iri english 6Phil iri english 6
Phil iri english 6Berth Daylo
 
fhcgvjblkhj.iouilkdcghvhhlksvagreement.ppt
fhcgvjblkhj.iouilkdcghvhhlksvagreement.pptfhcgvjblkhj.iouilkdcghvhhlksvagreement.ppt
fhcgvjblkhj.iouilkdcghvhhlksvagreement.pptAlangilanHigh
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.pptJimmiChunk
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.pptMnMVlog
 
Subject verb Agreement presentation for Students
Subject verb Agreement presentation for StudentsSubject verb Agreement presentation for Students
Subject verb Agreement presentation for Studentslogusps1999
 
K to 12 Grade 3 LAPG Reviewer
K to 12 Grade 3 LAPG ReviewerK to 12 Grade 3 LAPG Reviewer
K to 12 Grade 3 LAPG ReviewerLiGhT ArOhL
 
2023-03-25 Composting at Home 101 without link to voucher.pptx
2023-03-25 Composting at Home 101 without link to voucher.pptx2023-03-25 Composting at Home 101 without link to voucher.pptx
2023-03-25 Composting at Home 101 without link to voucher.pptxEllen Book
 
2023-05-27 Composting at Home 101 without voucher link.pptx
2023-05-27 Composting at Home 101 without voucher link.pptx2023-05-27 Composting at Home 101 without voucher link.pptx
2023-05-27 Composting at Home 101 without voucher link.pptxEllen Book
 
2023-05-27 Composting at Home 101 without voucher link.pptx
2023-05-27 Composting at Home 101 without voucher link.pptx2023-05-27 Composting at Home 101 without voucher link.pptx
2023-05-27 Composting at Home 101 without voucher link.pptxEllen Book
 

Ähnlich wie Ppt for ffa (14)

CONTEXT CLLUES.pptx
CONTEXT CLLUES.pptxCONTEXT CLLUES.pptx
CONTEXT CLLUES.pptx
 
pronoun -----agreement for primary s.ppt
pronoun -----agreement for primary s.pptpronoun -----agreement for primary s.ppt
pronoun -----agreement for primary s.ppt
 
Phil iri english 6
Phil iri english 6Phil iri english 6
Phil iri english 6
 
fhcgvjblkhj.iouilkdcghvhhlksvagreement.ppt
fhcgvjblkhj.iouilkdcghvhhlksvagreement.pptfhcgvjblkhj.iouilkdcghvhhlksvagreement.ppt
fhcgvjblkhj.iouilkdcghvhhlksvagreement.ppt
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
Subject verb Agreement presentation for Students
Subject verb Agreement presentation for StudentsSubject verb Agreement presentation for Students
Subject verb Agreement presentation for Students
 
K to 12 Grade 3 LAPG Reviewer
K to 12 Grade 3 LAPG ReviewerK to 12 Grade 3 LAPG Reviewer
K to 12 Grade 3 LAPG Reviewer
 
2023-03-25 Composting at Home 101 without link to voucher.pptx
2023-03-25 Composting at Home 101 without link to voucher.pptx2023-03-25 Composting at Home 101 without link to voucher.pptx
2023-03-25 Composting at Home 101 without link to voucher.pptx
 
2023-05-27 Composting at Home 101 without voucher link.pptx
2023-05-27 Composting at Home 101 without voucher link.pptx2023-05-27 Composting at Home 101 without voucher link.pptx
2023-05-27 Composting at Home 101 without voucher link.pptx
 
2023-05-27 Composting at Home 101 without voucher link.pptx
2023-05-27 Composting at Home 101 without voucher link.pptx2023-05-27 Composting at Home 101 without voucher link.pptx
2023-05-27 Composting at Home 101 without voucher link.pptx
 

Kürzlich hochgeladen

Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...
Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...
Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...christianmathematics
 
Mixin Classes in Odoo 17 How to Extend Models Using Mixin Classes
Mixin Classes in Odoo 17  How to Extend Models Using Mixin ClassesMixin Classes in Odoo 17  How to Extend Models Using Mixin Classes
Mixin Classes in Odoo 17 How to Extend Models Using Mixin ClassesCeline George
 
microwave assisted reaction. General introduction
microwave assisted reaction. General introductionmicrowave assisted reaction. General introduction
microwave assisted reaction. General introductionMaksud Ahmed
 
Class 11th Physics NEET formula sheet pdf
Class 11th Physics NEET formula sheet pdfClass 11th Physics NEET formula sheet pdf
Class 11th Physics NEET formula sheet pdfAyushMahapatra5
 
ICT Role in 21st Century Education & its Challenges.pptx
ICT Role in 21st Century Education & its Challenges.pptxICT Role in 21st Century Education & its Challenges.pptx
ICT Role in 21st Century Education & its Challenges.pptxAreebaZafar22
 
Unit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptxUnit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptxVishalSingh1417
 
The basics of sentences session 2pptx copy.pptx
The basics of sentences session 2pptx copy.pptxThe basics of sentences session 2pptx copy.pptx
The basics of sentences session 2pptx copy.pptxheathfieldcps1
 
Gardella_Mateo_IntellectualProperty.pdf.
Gardella_Mateo_IntellectualProperty.pdf.Gardella_Mateo_IntellectualProperty.pdf.
Gardella_Mateo_IntellectualProperty.pdf.MateoGardella
 
SOCIAL AND HISTORICAL CONTEXT - LFTVD.pptx
SOCIAL AND HISTORICAL CONTEXT - LFTVD.pptxSOCIAL AND HISTORICAL CONTEXT - LFTVD.pptx
SOCIAL AND HISTORICAL CONTEXT - LFTVD.pptxiammrhaywood
 
fourth grading exam for kindergarten in writing
fourth grading exam for kindergarten in writingfourth grading exam for kindergarten in writing
fourth grading exam for kindergarten in writingTeacherCyreneCayanan
 
Key note speaker Neum_Admir Softic_ENG.pdf
Key note speaker Neum_Admir Softic_ENG.pdfKey note speaker Neum_Admir Softic_ENG.pdf
Key note speaker Neum_Admir Softic_ENG.pdfAdmir Softic
 
Making and Justifying Mathematical Decisions.pdf
Making and Justifying Mathematical Decisions.pdfMaking and Justifying Mathematical Decisions.pdf
Making and Justifying Mathematical Decisions.pdfChris Hunter
 
1029-Danh muc Sach Giao Khoa khoi 6.pdf
1029-Danh muc Sach Giao Khoa khoi  6.pdf1029-Danh muc Sach Giao Khoa khoi  6.pdf
1029-Danh muc Sach Giao Khoa khoi 6.pdfQucHHunhnh
 
Grant Readiness 101 TechSoup and Remy Consulting
Grant Readiness 101 TechSoup and Remy ConsultingGrant Readiness 101 TechSoup and Remy Consulting
Grant Readiness 101 TechSoup and Remy ConsultingTechSoup
 
Unit-IV; Professional Sales Representative (PSR).pptx
Unit-IV; Professional Sales Representative (PSR).pptxUnit-IV; Professional Sales Representative (PSR).pptx
Unit-IV; Professional Sales Representative (PSR).pptxVishalSingh1417
 
How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17Celine George
 
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in DelhiRussian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhikauryashika82
 
Seal of Good Local Governance (SGLG) 2024Final.pptx
Seal of Good Local Governance (SGLG) 2024Final.pptxSeal of Good Local Governance (SGLG) 2024Final.pptx
Seal of Good Local Governance (SGLG) 2024Final.pptxnegromaestrong
 

Kürzlich hochgeladen (20)

Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...
Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...
Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...
 
Mixin Classes in Odoo 17 How to Extend Models Using Mixin Classes
Mixin Classes in Odoo 17  How to Extend Models Using Mixin ClassesMixin Classes in Odoo 17  How to Extend Models Using Mixin Classes
Mixin Classes in Odoo 17 How to Extend Models Using Mixin Classes
 
microwave assisted reaction. General introduction
microwave assisted reaction. General introductionmicrowave assisted reaction. General introduction
microwave assisted reaction. General introduction
 
Class 11th Physics NEET formula sheet pdf
Class 11th Physics NEET formula sheet pdfClass 11th Physics NEET formula sheet pdf
Class 11th Physics NEET formula sheet pdf
 
ICT Role in 21st Century Education & its Challenges.pptx
ICT Role in 21st Century Education & its Challenges.pptxICT Role in 21st Century Education & its Challenges.pptx
ICT Role in 21st Century Education & its Challenges.pptx
 
Unit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptxUnit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptx
 
The basics of sentences session 2pptx copy.pptx
The basics of sentences session 2pptx copy.pptxThe basics of sentences session 2pptx copy.pptx
The basics of sentences session 2pptx copy.pptx
 
Gardella_Mateo_IntellectualProperty.pdf.
Gardella_Mateo_IntellectualProperty.pdf.Gardella_Mateo_IntellectualProperty.pdf.
Gardella_Mateo_IntellectualProperty.pdf.
 
SOCIAL AND HISTORICAL CONTEXT - LFTVD.pptx
SOCIAL AND HISTORICAL CONTEXT - LFTVD.pptxSOCIAL AND HISTORICAL CONTEXT - LFTVD.pptx
SOCIAL AND HISTORICAL CONTEXT - LFTVD.pptx
 
Advance Mobile Application Development class 07
Advance Mobile Application Development class 07Advance Mobile Application Development class 07
Advance Mobile Application Development class 07
 
fourth grading exam for kindergarten in writing
fourth grading exam for kindergarten in writingfourth grading exam for kindergarten in writing
fourth grading exam for kindergarten in writing
 
Key note speaker Neum_Admir Softic_ENG.pdf
Key note speaker Neum_Admir Softic_ENG.pdfKey note speaker Neum_Admir Softic_ENG.pdf
Key note speaker Neum_Admir Softic_ENG.pdf
 
Making and Justifying Mathematical Decisions.pdf
Making and Justifying Mathematical Decisions.pdfMaking and Justifying Mathematical Decisions.pdf
Making and Justifying Mathematical Decisions.pdf
 
1029-Danh muc Sach Giao Khoa khoi 6.pdf
1029-Danh muc Sach Giao Khoa khoi  6.pdf1029-Danh muc Sach Giao Khoa khoi  6.pdf
1029-Danh muc Sach Giao Khoa khoi 6.pdf
 
Mattingly "AI & Prompt Design: The Basics of Prompt Design"
Mattingly "AI & Prompt Design: The Basics of Prompt Design"Mattingly "AI & Prompt Design: The Basics of Prompt Design"
Mattingly "AI & Prompt Design: The Basics of Prompt Design"
 
Grant Readiness 101 TechSoup and Remy Consulting
Grant Readiness 101 TechSoup and Remy ConsultingGrant Readiness 101 TechSoup and Remy Consulting
Grant Readiness 101 TechSoup and Remy Consulting
 
Unit-IV; Professional Sales Representative (PSR).pptx
Unit-IV; Professional Sales Representative (PSR).pptxUnit-IV; Professional Sales Representative (PSR).pptx
Unit-IV; Professional Sales Representative (PSR).pptx
 
How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17
 
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in DelhiRussian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
 
Seal of Good Local Governance (SGLG) 2024Final.pptx
Seal of Good Local Governance (SGLG) 2024Final.pptxSeal of Good Local Governance (SGLG) 2024Final.pptx
Seal of Good Local Governance (SGLG) 2024Final.pptx
 

Ppt for ffa

  • 1. Society of St. Andrew gleaning america’s fields, feeding america’s hungry Why is so much good food available to glean and distribute to the hungry? Take our quiz to see if you know why!
  • 2. These beans are headed for a landfill. What’s wrong with them?
  • 3. A. They are not fresh. B. Nobody likes green beans. C. They are the wrong length. D. They have botulism spores.
  • 4. A. They are not fresh. B. Nobody likes green beans. C. They are the wrong length. D. They have botulism spores.
  • 5. These strawberries are headed for a landfill. What’s wrong with them?
  • 6. A. Strawberries are too messy. B. They have an insect problem. C. Somebody dropped them. D. The farm closed for the season.
  • 7. A. Strawberries are too messy. B. They have an insect problem. C. Somebody dropped them. D. The farm closed for the season.
  • 8. These potatoes are headed for a landfill. What’s wrong with them?
  • 9. A. They are moldy. B. They have blemishes. C. Bird’s Eye changed packaging. D. People prefer 5-lb bags.
  • 10. A. They are moldy. B. They have blemishes. C. Bird’s Eye changed packaging. D. People prefer 5-lb bags.
  • 11. These potatoes are headed for a landfill. What’s wrong with them?
  • 12. A. They were delivered to the wrong place. B. The flavor is off. C. They are last year’s potatoes. D. They are the wrong shape.
  • 13. A. They were delivered to the wrong place. B. The flavor is off. C. They are last year’s potatoes. D. They are the wrong shape.
  • 14.
  • 15. This corn is headed for a landfill. What’s wrong with it?
  • 16. A. They were the second and third ears on each stalk. B. They have pesticide residue. C. The ears are wormy. D. They fell off the truck.
  • 17. A. They were the second and third ears on each stalk. B. They have pesticide residue. C. The ears are wormy. D. They fell off the truck.
  • 18. These tomatoes are headed for a landfill. What’s wrong with them?
  • 19. A. They weren’t refrigerated. B. They are misshapen. C. They are too ripe. D. They are squished.
  • 20. A. They weren’t refrigerated. B. They are misshapen. C. They are too ripe. D. They are squished.
  • 21. These peaches are headed for a landfill. What’s wrong with them?
  • 22. A. They were overlooked at harvest. B. They are bruised. C. They didn’t get sold. D. They are too big.
  • 23. A. They were overlooked at harvest. B. They are bruised. C. They didn’t get sold. D. They are too big.
  • 24. Meanwhile, 50 million Americans struggle to put food on their tables.
  • 25. In 2012, with the help of 40,300 volunteers the Society of St. Andrew put 100 million servings of fresh fruits and vegetables on the tables of people at risk for hunger across the US
  • 26. Society of St. Andrew 3383 Sweet Hollow Road Big Island, VA 24526 800-333-4597 Look for us on Facebook & Twitter! ENDhunger.org