SlideShare ist ein Scribd-Unternehmen logo
1 von 13
Introduction to Virtualization
• History of Virtualization
– Mainframe origins
– Computers in the 1990s & 2000s
– Resulting IT challenges
• What is Virtualization
– Key technology for today
– Physical Server vs. Virtual Server
– Virtualization layer
– Virtual Machines
Virtualization History
• Born from Mainframe Technology:
– Originally part of mainframe technology, virtualization is not a new concept.
– Mainframes started as very large computers in the 1960s to process compute
tasks.
Virtualization on a Mainframe
• Mainframe Virtualization:
– Concept was to split the computer into multiple virtual machines so different “tasks”
can be run separately and independently on the same mainframe.
– If one virtual machine or “task” has a problem, other virtual machines are unaffected
VM #1
Task A
Mainframe Sample Diagram
VM #2
Task B
VM #3
Task C
VM #4
Task D
VM #5
Task E
VM #6
Task F
VM #7
Task G
Computers in 1990s
• Fast Forward to the 1990s
– Intel/AMD servers now very popular (known as “x86” servers)
– Each server runs Operating Systems such as Microsoft, Linux, or Netware
– Companies put ONE operating system & ONE application on each server
– 2 servers would grow to 6 servers, eventually to 50 or more servers!
– Electricity and space (footprint) becomes a problem….
File
Server
Web
Server
File
Server Web
Server
File
Server
Domain
ServerApp
Server
DNS
Server
Each Server Running
1 Application
Computers in 2000s
• Fast Forward to the 2000s
– Manufacturers “to the rescue”!
– Focus on making servers small
– “Rack” form factors (6-20 servers per cabinet)
– “Blade” form factors (30-60 servers per cabinet)
– Space/footprint problem helped….some
– Electricity and heat still a problem
Example Dell “Rack” Servers
Example HP “Blade” Servers
• As Servers Got Faster…
– Server utilization became even lower
– Average server utilization ranges between 4 -10%
– STILL one application per server
Today’s IT Challenges
Continued Server Sprawl
– Power, space and cooling costs represent one of the largest IT
budget line items
– One-application-per-server approach leads to complexity and high
costs of equipment and administration
Low Server Utilization Rates
– Result in excessive acquisition and maintenance costs
What this Equates to Today:
Virtualization is the Key
Apply Mainframe Virtualization Concepts to Intel / AMD Servers:
– Use virtualization software to partition an Intel / AMD server to work with several
operating system and application “instances”
Oracle SQL Application Servers Email File Print DNS Domain
Deploy several “virtual machines”
on one server using groundbreaking
virtualization software
Traditional Physical Server
Traditional x86 Server Architecture
– Single operating system per
machine
– Single application per machine
– Hardware components connected
directly to operating system
• CPU
• Memory
• Disk
• Network Card
x86 Architecture
Operating System
Application
CPU Memory Disk Network
1 Physical Server, 1 Application
New Architecture: Virtual Server
Virtualization Layer
– Addition of a virtualization
layer called a “hypervisor”
– Several servers can be
deployed as Virtual Machines
(VM) on each physical box
– Each VM has its own
operating system and
application
– Can run multiple, different
operating systems on the
same machine
– If one VM fails, other VMs are
unaffected
x86 Architecture
Application
Microsoft
OS
CPU (s)
Memory
vDisk
vLAN
Application
Microsoft
OS
CPU (s)
Memory
vDisk
vLAN
Application
Linux
OS
CPU (s)
Memory
vDisk
vLAN
Virtualization Layer (Hypervisor)
CPU Memory Disk Network
3 Virtual Servers on 1 Physical Server
Virtualization Layer Explored
Virtualization Layer - Compatibility
– A virtual machine is compatible with standard x86 operating
systems such as Windows and Linux
– A virtual machine has a motherboard, cpu, memory, disk and
network just like a physical server
– Applications developed for the standard OS’s will work on a
virtual machine
– No adjustments are needed to run applications on virtual servers
Virtualization Layer - Isolation
– Virtual machines on the same physical machine run
independently
– They are protected from each other
Virtual Machines Explored
Virtual Machines
– A virtual machine is a collection of software that has been
translated into files
– These files are collected and organized in “containers”
– These containers can be moved in seconds from one physical
machine to another in case of physical server failure or
performance needs.
– Virtual machines have all the same hardware resources
available such as CPU, memory, disk, and network
Server Virtualization In the Enterprise
Reduced
CapEx, Increased
Utilization
Reduced Cost of HA
and DR
Business Value
Virtualization Use
High Availability &
Disaster Recovery
Rapid
Provisioning
Server
Consolidation
Reduced
Operational Costs
Capacity
Management
Operational Efficiency
Policy-based
Automation
Any app, any
resource, any time
Improve resource
utilization, get
more out of
today’s fast
industry-standard
hardware
Quickly and
cheaply set up
development,
test, and
production
environments
Recover from
failures quickly,
reliably and
cost-efficiently
Match workloads
with available
capacity to
optimize
efficiency and
manage SLA’s
Automate to
reduce manual
intervention,
human errors,
time and labor
costs
Virtual Technologies
• Virtual Technologies designs and implements virtualization
solutions for business, education and government entities
• Offers world-class virtualization software products from
partners such as Virtualiron, VMware, and XenSource and
hardware products from HP, Dell & Compellent
• Provides a total package: assessment, product selection,
implementation and support
• Working with Regional Utility Companies to offer rebates for
customers who “virtualize”

Weitere ähnliche Inhalte

Was ist angesagt?

Virtualization presentation
Virtualization presentationVirtualization presentation
Virtualization presentation
Mangesh Gunjal
 

Was ist angesagt? (20)

Vmware overview
Vmware overviewVmware overview
Vmware overview
 
Virtualization presentation
Virtualization presentationVirtualization presentation
Virtualization presentation
 
Virtualization
VirtualizationVirtualization
Virtualization
 
Virtualization
VirtualizationVirtualization
Virtualization
 
VMware Tutorial For Beginners | VMware Workstation | VMware Virtualization | ...
VMware Tutorial For Beginners | VMware Workstation | VMware Virtualization | ...VMware Tutorial For Beginners | VMware Workstation | VMware Virtualization | ...
VMware Tutorial For Beginners | VMware Workstation | VMware Virtualization | ...
 
What is Virtualization and its types & Techniques.What is hypervisor and its ...
What is Virtualization and its types & Techniques.What is hypervisor and its ...What is Virtualization and its types & Techniques.What is hypervisor and its ...
What is Virtualization and its types & Techniques.What is hypervisor and its ...
 
Virtualization VMWare technology
Virtualization VMWare technologyVirtualization VMWare technology
Virtualization VMWare technology
 
VMware Vsphere Graduation Project Presentation
VMware Vsphere Graduation Project PresentationVMware Vsphere Graduation Project Presentation
VMware Vsphere Graduation Project Presentation
 
Cloud Computing: Virtualization
Cloud Computing: VirtualizationCloud Computing: Virtualization
Cloud Computing: Virtualization
 
Virtualization
VirtualizationVirtualization
Virtualization
 
Virtualization
VirtualizationVirtualization
Virtualization
 
VMware vSphere
VMware vSphereVMware vSphere
VMware vSphere
 
Presentation citrix desktop virtualization
Presentation   citrix desktop virtualizationPresentation   citrix desktop virtualization
Presentation citrix desktop virtualization
 
Virtualization in cloud computing ppt
Virtualization in cloud computing pptVirtualization in cloud computing ppt
Virtualization in cloud computing ppt
 
Virtualization
VirtualizationVirtualization
Virtualization
 
VMware Virtualization
VMware Virtualization VMware Virtualization
VMware Virtualization
 
Virtualization 101: Everything You Need To Know To Get Started With VMware
Virtualization 101: Everything You Need To Know To Get Started With VMwareVirtualization 101: Everything You Need To Know To Get Started With VMware
Virtualization 101: Everything You Need To Know To Get Started With VMware
 
Vitualisation
VitualisationVitualisation
Vitualisation
 
Introduction to Hyper-V
Introduction to Hyper-VIntroduction to Hyper-V
Introduction to Hyper-V
 
Virtual machines and containers
Virtual machines and containersVirtual machines and containers
Virtual machines and containers
 

Andere mochten auch (6)

Mastering KVM Virtualization - Overview
Mastering KVM Virtualization - OverviewMastering KVM Virtualization - Overview
Mastering KVM Virtualization - Overview
 
Simple Virtualization Overview
Simple Virtualization OverviewSimple Virtualization Overview
Simple Virtualization Overview
 
Introduction to Virtualization
Introduction to VirtualizationIntroduction to Virtualization
Introduction to Virtualization
 
Intoduction to VirtualBox English
Intoduction to VirtualBox EnglishIntoduction to VirtualBox English
Intoduction to VirtualBox English
 
A Xen Case Study
A Xen Case StudyA Xen Case Study
A Xen Case Study
 
1.Introduction to virtualization
1.Introduction to virtualization1.Introduction to virtualization
1.Introduction to virtualization
 

Ähnlich wie Virtualisation basics

An Introduction To Server Virtualisation
An Introduction To Server VirtualisationAn Introduction To Server Virtualisation
An Introduction To Server Virtualisation
Alan McSweeney
 
Server Virtualization
Server VirtualizationServer Virtualization
Server Virtualization
webhostingguy
 
vmware-1224141832021349-8.pptx
vmware-1224141832021349-8.pptxvmware-1224141832021349-8.pptx
vmware-1224141832021349-8.pptx
yashvirsingh48
 

Ähnlich wie Virtualisation basics (20)

Virtualization
VirtualizationVirtualization
Virtualization
 
unit 2.ppt
unit 2.pptunit 2.ppt
unit 2.ppt
 
Virtualization intro to freshers
Virtualization intro to freshersVirtualization intro to freshers
Virtualization intro to freshers
 
Sameer Mitter | Introduction to Cloud computing
Sameer Mitter | Introduction to Cloud computingSameer Mitter | Introduction to Cloud computing
Sameer Mitter | Introduction to Cloud computing
 
Introduction to Virtualization
Introduction to Virtualization Introduction to Virtualization
Introduction to Virtualization
 
9-cloud-computing.pdf
9-cloud-computing.pdf9-cloud-computing.pdf
9-cloud-computing.pdf
 
An Introduction To Server Virtualisation
An Introduction To Server VirtualisationAn Introduction To Server Virtualisation
An Introduction To Server Virtualisation
 
Virtualization in cloud
Virtualization in cloudVirtualization in cloud
Virtualization in cloud
 
Introduction to virtualization
Introduction to virtualizationIntroduction to virtualization
Introduction to virtualization
 
Cloud virtualization
Cloud virtualizationCloud virtualization
Cloud virtualization
 
Deco1
Deco1Deco1
Deco1
 
Cloud ppt
Cloud pptCloud ppt
Cloud ppt
 
101 Virtualization and Private Cloud
101 Virtualization and Private Cloud101 Virtualization and Private Cloud
101 Virtualization and Private Cloud
 
Cloud computing
Cloud computingCloud computing
Cloud computing
 
Introduction to Cloud Computing
Introduction to Cloud Computing Introduction to Cloud Computing
Introduction to Cloud Computing
 
Virtualization @ Sehir
Virtualization @ SehirVirtualization @ Sehir
Virtualization @ Sehir
 
Server Virtualization
Server VirtualizationServer Virtualization
Server Virtualization
 
vmware-1224141832021349-8.pptx
vmware-1224141832021349-8.pptxvmware-1224141832021349-8.pptx
vmware-1224141832021349-8.pptx
 
Virtualization ppt1
Virtualization ppt1Virtualization ppt1
Virtualization ppt1
 
vmwareyudyufudifyulllllllwedwlidwelil.ppt
vmwareyudyufudifyulllllllwedwlidwelil.pptvmwareyudyufudifyulllllllwedwlidwelil.ppt
vmwareyudyufudifyulllllllwedwlidwelil.ppt
 

Mehr von sagaroceanic11

Module 21 investigative reports
Module 21 investigative reportsModule 21 investigative reports
Module 21 investigative reports
sagaroceanic11
 
Module 20 mobile forensics
Module 20 mobile forensicsModule 20 mobile forensics
Module 20 mobile forensics
sagaroceanic11
 
Module 19 tracking emails and investigating email crimes
Module 19 tracking emails and investigating email crimesModule 19 tracking emails and investigating email crimes
Module 19 tracking emails and investigating email crimes
sagaroceanic11
 
Module 18 investigating web attacks
Module 18 investigating web attacksModule 18 investigating web attacks
Module 18 investigating web attacks
sagaroceanic11
 
Module 17 investigating wireless attacks
Module 17 investigating wireless attacksModule 17 investigating wireless attacks
Module 17 investigating wireless attacks
sagaroceanic11
 
Module 04 digital evidence
Module 04 digital evidenceModule 04 digital evidence
Module 04 digital evidence
sagaroceanic11
 
Module 03 searching and seizing computers
Module 03 searching and seizing computersModule 03 searching and seizing computers
Module 03 searching and seizing computers
sagaroceanic11
 
Module 01 computer forensics in todays world
Module 01 computer forensics in todays worldModule 01 computer forensics in todays world
Module 01 computer forensics in todays world
sagaroceanic11
 
Virtualisation with v mware
Virtualisation with v mwareVirtualisation with v mware
Virtualisation with v mware
sagaroceanic11
 
Virtualisation overview
Virtualisation overviewVirtualisation overview
Virtualisation overview
sagaroceanic11
 
Introduction to virtualisation
Introduction to virtualisationIntroduction to virtualisation
Introduction to virtualisation
sagaroceanic11
 
2 the service lifecycle
2 the service lifecycle2 the service lifecycle
2 the service lifecycle
sagaroceanic11
 
1 introduction to itil v[1].3
1 introduction to itil v[1].31 introduction to itil v[1].3
1 introduction to itil v[1].3
sagaroceanic11
 
Visual studio 2008 overview
Visual studio 2008 overviewVisual studio 2008 overview
Visual studio 2008 overview
sagaroceanic11
 

Mehr von sagaroceanic11 (20)

Module 21 investigative reports
Module 21 investigative reportsModule 21 investigative reports
Module 21 investigative reports
 
Module 20 mobile forensics
Module 20 mobile forensicsModule 20 mobile forensics
Module 20 mobile forensics
 
Module 19 tracking emails and investigating email crimes
Module 19 tracking emails and investigating email crimesModule 19 tracking emails and investigating email crimes
Module 19 tracking emails and investigating email crimes
 
Module 18 investigating web attacks
Module 18 investigating web attacksModule 18 investigating web attacks
Module 18 investigating web attacks
 
Module 17 investigating wireless attacks
Module 17 investigating wireless attacksModule 17 investigating wireless attacks
Module 17 investigating wireless attacks
 
Module 04 digital evidence
Module 04 digital evidenceModule 04 digital evidence
Module 04 digital evidence
 
Module 03 searching and seizing computers
Module 03 searching and seizing computersModule 03 searching and seizing computers
Module 03 searching and seizing computers
 
Module 01 computer forensics in todays world
Module 01 computer forensics in todays worldModule 01 computer forensics in todays world
Module 01 computer forensics in todays world
 
Virtualisation with v mware
Virtualisation with v mwareVirtualisation with v mware
Virtualisation with v mware
 
Virtualisation overview
Virtualisation overviewVirtualisation overview
Virtualisation overview
 
Introduction to virtualisation
Introduction to virtualisationIntroduction to virtualisation
Introduction to virtualisation
 
6 service operation
6 service operation6 service operation
6 service operation
 
5 service transition
5 service transition5 service transition
5 service transition
 
4 service design
4 service design4 service design
4 service design
 
3 service strategy
3 service strategy3 service strategy
3 service strategy
 
2 the service lifecycle
2 the service lifecycle2 the service lifecycle
2 the service lifecycle
 
1 introduction to itil v[1].3
1 introduction to itil v[1].31 introduction to itil v[1].3
1 introduction to itil v[1].3
 
Visual studio 2008 overview
Visual studio 2008 overviewVisual studio 2008 overview
Visual studio 2008 overview
 
Vb introduction.
Vb introduction.Vb introduction.
Vb introduction.
 
Vb essentials
Vb essentialsVb essentials
Vb essentials
 

Kürzlich hochgeladen

Why Teams call analytics are critical to your entire business
Why Teams call analytics are critical to your entire businessWhy Teams call analytics are critical to your entire business
Why Teams call analytics are critical to your entire business
panagenda
 
Cloud Frontiers: A Deep Dive into Serverless Spatial Data and FME
Cloud Frontiers:  A Deep Dive into Serverless Spatial Data and FMECloud Frontiers:  A Deep Dive into Serverless Spatial Data and FME
Cloud Frontiers: A Deep Dive into Serverless Spatial Data and FME
Safe Software
 

Kürzlich hochgeladen (20)

Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...
Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...
Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...
 
Artificial Intelligence Chap.5 : Uncertainty
Artificial Intelligence Chap.5 : UncertaintyArtificial Intelligence Chap.5 : Uncertainty
Artificial Intelligence Chap.5 : Uncertainty
 
TrustArc Webinar - Stay Ahead of US State Data Privacy Law Developments
TrustArc Webinar - Stay Ahead of US State Data Privacy Law DevelopmentsTrustArc Webinar - Stay Ahead of US State Data Privacy Law Developments
TrustArc Webinar - Stay Ahead of US State Data Privacy Law Developments
 
Web Form Automation for Bonterra Impact Management (fka Social Solutions Apri...
Web Form Automation for Bonterra Impact Management (fka Social Solutions Apri...Web Form Automation for Bonterra Impact Management (fka Social Solutions Apri...
Web Form Automation for Bonterra Impact Management (fka Social Solutions Apri...
 
How to Troubleshoot Apps for the Modern Connected Worker
How to Troubleshoot Apps for the Modern Connected WorkerHow to Troubleshoot Apps for the Modern Connected Worker
How to Troubleshoot Apps for the Modern Connected Worker
 
A Beginners Guide to Building a RAG App Using Open Source Milvus
A Beginners Guide to Building a RAG App Using Open Source MilvusA Beginners Guide to Building a RAG App Using Open Source Milvus
A Beginners Guide to Building a RAG App Using Open Source Milvus
 
Why Teams call analytics are critical to your entire business
Why Teams call analytics are critical to your entire businessWhy Teams call analytics are critical to your entire business
Why Teams call analytics are critical to your entire business
 
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...
 
ProductAnonymous-April2024-WinProductDiscovery-MelissaKlemke
ProductAnonymous-April2024-WinProductDiscovery-MelissaKlemkeProductAnonymous-April2024-WinProductDiscovery-MelissaKlemke
ProductAnonymous-April2024-WinProductDiscovery-MelissaKlemke
 
Exploring the Future Potential of AI-Enabled Smartphone Processors
Exploring the Future Potential of AI-Enabled Smartphone ProcessorsExploring the Future Potential of AI-Enabled Smartphone Processors
Exploring the Future Potential of AI-Enabled Smartphone Processors
 
EMPOWERMENT TECHNOLOGY GRADE 11 QUARTER 2 REVIEWER
EMPOWERMENT TECHNOLOGY GRADE 11 QUARTER 2 REVIEWEREMPOWERMENT TECHNOLOGY GRADE 11 QUARTER 2 REVIEWER
EMPOWERMENT TECHNOLOGY GRADE 11 QUARTER 2 REVIEWER
 
Repurposing LNG terminals for Hydrogen Ammonia: Feasibility and Cost Saving
Repurposing LNG terminals for Hydrogen Ammonia: Feasibility and Cost SavingRepurposing LNG terminals for Hydrogen Ammonia: Feasibility and Cost Saving
Repurposing LNG terminals for Hydrogen Ammonia: Feasibility and Cost Saving
 
Cloud Frontiers: A Deep Dive into Serverless Spatial Data and FME
Cloud Frontiers:  A Deep Dive into Serverless Spatial Data and FMECloud Frontiers:  A Deep Dive into Serverless Spatial Data and FME
Cloud Frontiers: A Deep Dive into Serverless Spatial Data and FME
 
Apidays Singapore 2024 - Scalable LLM APIs for AI and Generative AI Applicati...
Apidays Singapore 2024 - Scalable LLM APIs for AI and Generative AI Applicati...Apidays Singapore 2024 - Scalable LLM APIs for AI and Generative AI Applicati...
Apidays Singapore 2024 - Scalable LLM APIs for AI and Generative AI Applicati...
 
Corporate and higher education May webinar.pptx
Corporate and higher education May webinar.pptxCorporate and higher education May webinar.pptx
Corporate and higher education May webinar.pptx
 
Apidays New York 2024 - The value of a flexible API Management solution for O...
Apidays New York 2024 - The value of a flexible API Management solution for O...Apidays New York 2024 - The value of a flexible API Management solution for O...
Apidays New York 2024 - The value of a flexible API Management solution for O...
 
A Year of the Servo Reboot: Where Are We Now?
A Year of the Servo Reboot: Where Are We Now?A Year of the Servo Reboot: Where Are We Now?
A Year of the Servo Reboot: Where Are We Now?
 
ICT role in 21st century education and its challenges
ICT role in 21st century education and its challengesICT role in 21st century education and its challenges
ICT role in 21st century education and its challenges
 
Real Time Object Detection Using Open CV
Real Time Object Detection Using Open CVReal Time Object Detection Using Open CV
Real Time Object Detection Using Open CV
 
Data Cloud, More than a CDP by Matt Robison
Data Cloud, More than a CDP by Matt RobisonData Cloud, More than a CDP by Matt Robison
Data Cloud, More than a CDP by Matt Robison
 

Virtualisation basics

  • 1. Introduction to Virtualization • History of Virtualization – Mainframe origins – Computers in the 1990s & 2000s – Resulting IT challenges • What is Virtualization – Key technology for today – Physical Server vs. Virtual Server – Virtualization layer – Virtual Machines
  • 2. Virtualization History • Born from Mainframe Technology: – Originally part of mainframe technology, virtualization is not a new concept. – Mainframes started as very large computers in the 1960s to process compute tasks.
  • 3. Virtualization on a Mainframe • Mainframe Virtualization: – Concept was to split the computer into multiple virtual machines so different “tasks” can be run separately and independently on the same mainframe. – If one virtual machine or “task” has a problem, other virtual machines are unaffected VM #1 Task A Mainframe Sample Diagram VM #2 Task B VM #3 Task C VM #4 Task D VM #5 Task E VM #6 Task F VM #7 Task G
  • 4. Computers in 1990s • Fast Forward to the 1990s – Intel/AMD servers now very popular (known as “x86” servers) – Each server runs Operating Systems such as Microsoft, Linux, or Netware – Companies put ONE operating system & ONE application on each server – 2 servers would grow to 6 servers, eventually to 50 or more servers! – Electricity and space (footprint) becomes a problem…. File Server Web Server File Server Web Server File Server Domain ServerApp Server DNS Server Each Server Running 1 Application
  • 5. Computers in 2000s • Fast Forward to the 2000s – Manufacturers “to the rescue”! – Focus on making servers small – “Rack” form factors (6-20 servers per cabinet) – “Blade” form factors (30-60 servers per cabinet) – Space/footprint problem helped….some – Electricity and heat still a problem Example Dell “Rack” Servers Example HP “Blade” Servers • As Servers Got Faster… – Server utilization became even lower – Average server utilization ranges between 4 -10% – STILL one application per server
  • 6. Today’s IT Challenges Continued Server Sprawl – Power, space and cooling costs represent one of the largest IT budget line items – One-application-per-server approach leads to complexity and high costs of equipment and administration Low Server Utilization Rates – Result in excessive acquisition and maintenance costs What this Equates to Today:
  • 7. Virtualization is the Key Apply Mainframe Virtualization Concepts to Intel / AMD Servers: – Use virtualization software to partition an Intel / AMD server to work with several operating system and application “instances” Oracle SQL Application Servers Email File Print DNS Domain Deploy several “virtual machines” on one server using groundbreaking virtualization software
  • 8. Traditional Physical Server Traditional x86 Server Architecture – Single operating system per machine – Single application per machine – Hardware components connected directly to operating system • CPU • Memory • Disk • Network Card x86 Architecture Operating System Application CPU Memory Disk Network 1 Physical Server, 1 Application
  • 9. New Architecture: Virtual Server Virtualization Layer – Addition of a virtualization layer called a “hypervisor” – Several servers can be deployed as Virtual Machines (VM) on each physical box – Each VM has its own operating system and application – Can run multiple, different operating systems on the same machine – If one VM fails, other VMs are unaffected x86 Architecture Application Microsoft OS CPU (s) Memory vDisk vLAN Application Microsoft OS CPU (s) Memory vDisk vLAN Application Linux OS CPU (s) Memory vDisk vLAN Virtualization Layer (Hypervisor) CPU Memory Disk Network 3 Virtual Servers on 1 Physical Server
  • 10. Virtualization Layer Explored Virtualization Layer - Compatibility – A virtual machine is compatible with standard x86 operating systems such as Windows and Linux – A virtual machine has a motherboard, cpu, memory, disk and network just like a physical server – Applications developed for the standard OS’s will work on a virtual machine – No adjustments are needed to run applications on virtual servers Virtualization Layer - Isolation – Virtual machines on the same physical machine run independently – They are protected from each other
  • 11. Virtual Machines Explored Virtual Machines – A virtual machine is a collection of software that has been translated into files – These files are collected and organized in “containers” – These containers can be moved in seconds from one physical machine to another in case of physical server failure or performance needs. – Virtual machines have all the same hardware resources available such as CPU, memory, disk, and network
  • 12. Server Virtualization In the Enterprise Reduced CapEx, Increased Utilization Reduced Cost of HA and DR Business Value Virtualization Use High Availability & Disaster Recovery Rapid Provisioning Server Consolidation Reduced Operational Costs Capacity Management Operational Efficiency Policy-based Automation Any app, any resource, any time Improve resource utilization, get more out of today’s fast industry-standard hardware Quickly and cheaply set up development, test, and production environments Recover from failures quickly, reliably and cost-efficiently Match workloads with available capacity to optimize efficiency and manage SLA’s Automate to reduce manual intervention, human errors, time and labor costs
  • 13. Virtual Technologies • Virtual Technologies designs and implements virtualization solutions for business, education and government entities • Offers world-class virtualization software products from partners such as Virtualiron, VMware, and XenSource and hardware products from HP, Dell & Compellent • Provides a total package: assessment, product selection, implementation and support • Working with Regional Utility Companies to offer rebates for customers who “virtualize”

Hinweis der Redaktion

  1. We see customers deploying virtualization to solve the following problems. Most customers start with consolidation to improve average server utilization to get more out of today’s fast industry standard hardware Then users use virtual servers to quickly and cheaply set up development, test, and production environments Availability features allow users to recover from failures quickly, reliably and cost-efficiently (using N+1 hardware versus 2N) and simplifying reconfigurations for DR scenarios Match the capacity to workload (Optimize your equipment for efficiency) Reduce the human labor needed through policy-based automation (reduce human error, reduce # of human resources needed)