SlideShare ist ein Scribd-Unternehmen logo
1 von 23
This presentation is
brought to you by
Grammar Bytes!,
©2019 by Robin L.
Simmons.
Verb Forms
I know you can
say hook ,
hooked ...
But can you
say took,
tooked?
This
presentation
covers the use
of standard
regular and
irregular verb
forms.
A verb form item on an
objective test might look
like this ...
Sample Item
Thomas sang along until the CD ended; then as
he was choosing a new disk, he lost control of
the car and drived into a ditch.
A. sung
B. chosing
C. drove
D. No change is necessary.
Thomas sang along until the CD ended; then as
A
he was choosing a new disk, he lost control of
B
the car and drived into a ditch.
C
A. sung
B. chosing
C. drove
D. No change is necessary.
Thomas sang along until the CD ended; then as
A
he was choosing a new disk, he lost control of
B
the car and drove into a ditch.
C
A. sung
B. chosing
C. drove
D. No change is necessary.
Is sang,
choosing, or
drived a badly
formed verb?
Drived is
incorrect, which
option C fixes.
Regular verbs have reliable
forms.
Infinitive
Simple
Present
Simple
Past
Past
Participle
Present
Participle
to laugh laugh(s) laughed laughed laughing
to start start(s) started started starting
to travel travel(s) traveled traveled traveling
Or to fish,
fish(es), fished,
fished, fishing!
Irregular verbs, however,
have no consistent patterns.
Infinitive
Simple
Present
Simple
Past
Past
Participle
Present
Participle
to drive drive(s) drove driven driving
to think think(s) thought thought thinking
to drink drink(s) drank drunk drinking
to swim swim(s) swam swum swimming
For example, to catch,
catch(es), caught,
caught, catching!
On many objective exams,
you cannot use a dictionar y
to look up the correct form!
X
When in doubt, rely on
“gut” feelings.
Hey, I’ve seen
that verb
before!
Your eyes have seen in print—and your
brain has registered—all of the possible
verb forms that you will encounter for this
skill. If you don’t recognize the right
answer, go with the one that feels right.
Instead of skipping class to go fishing,
Yolanda should of studied for her
accounting exam.
Don’t confuse of and
have.
My grade
was a
disaster!
Instead of skipping class to go fishing,
Yolanda should have studied for her
accounting exam.
Confirm that used to is in
the past tense.
Now that he’s older, Fred has a full-time job,
but he use to spend his summers fishing.
You’re a bad
influence!
Now that he’s older, Fred has a full-time job,
but he used to spend his summers fishing.
Quick Test
Directions: In the items that follow, choose
the option that corrects an error in the
underlined portion(s). If no error exists, choose
“No change is necessary.”
Show me
what you
know.
Item 1
We knew that Charley had hid the cookies in
his bedroom, so we stole his key and searched in
all the dresser drawers.
A. knowed
B. hidden
C. stealed
D. No change is necessary.
We knew that Charley had hid the cookies in
A B
his bedroom, so we stole his key and searched in
C
all the dresser drawers.
A. knowed
B. hidden
C. stealed
D. No change is necessary.
We knew that Charley had hidden the cookies in
A B
his bedroom, so we stole his key and searched in
C
all the dresser drawers.
A. knowed
B. hidden
C. stealed
D. No change is necessary.
Item 2
If we had known that you were serving squid
eyeball stew, we would of come for dinner!
A. of came
B. have came
C. have come
D. No change is necessary.
If we had known that you were serving squid
eyeball stew, we would of come for dinner!
A. of came
B. have came
C. have come
D. No change is necessary.
If we had known that you were serving squid
eyeball stew, we would of come for dinner!
A. of came
B. have came
C. have come
D. No change is necessary.
Item 3
Priscilla use to have a pet parakeet; her mother’s
story is that the bird escaped and flew away, but
Priscilla believes that the cat ate it.
A. used
B. flied
C. eaten
D. No change is necessary.
Priscilla use to have a pet parakeet; her mother’s
A
story is that the bird escaped and flew away, but
B
Priscilla believes that the cat ate it.
C
A. used
B. flied
C. eaten
D. No change is necessary.
Priscilla used to have a pet parakeet; her mother’s
A
story is that the bird escaped and flew away, but
B
Priscilla believes that the cat ate it.
C
A. used
B. flied
C. eaten
D. No change is necessary.
Item 4
Julissa was soaked during the afternoon
thunderstorm because she had choosed to walk to
school rather than drive.
A. chosen
B. choosen
C. chose
D. No change is necessary.
Julissa was soaked during the afternoon
thunderstorm because she had choosed to walk to
school rather than drive.
A. chosen
B. choosen
C. chose
D. No change is necessary.
Julissa was soaked during the afternoon
thunderstorm because she had choosed to walk to
school rather than drive.
A. chosen
B. choosen
C. chose
D. No change is necessary.
Item 5
James brung roses and begged forgiveness, but
when Rhonda saw that her ex still hadn’t shaved
his ridiculous mustache, she shut the door in his
face.
A. brought
B. seen
C. shutted
D. No change is necessary.
James brung roses and begged forgiveness, but
A
when Rhonda saw that her ex still hadn’t shaved
B
his ridiculous mustache, she shut the door in his
C
face.
A. brought
B. seen
C. shutted
D. No change is necessary.
James brought roses and begged forgiveness, but
A
when Rhonda saw that her ex still hadn’t shaved
B
his ridiculous mustache, she shut the door in his
C
face.
A. brought
B. seen
C. shutted
D. No change is necessary.
Item 6
If Toby had tooken Charlene’s advice, that bottle of
soda wouldn’t have exploded all over the front of
his new white shirt.
A. took
B. tooked
C. taken
D. No change is necessary.
If Toby had tooken Charlene’s advice, that bottle of
soda wouldn’t have exploded all over the front of
his new white shirt.
A. took
B. tooked
C. taken
D. No change is necessary.
If Toby had tooken Charlene’s advice, that bottle of
soda wouldn’t have exploded all over the front of
his new white shirt.
A. took
B. tooked
C. taken
D. No change is necessary.
Item 7
Cooper laid the 10-page paper on Professor
Cook’s desk; he had wrote the last sentence at
2:50 p.m., and then he ran across campus to
deliver the work by the 3 o’clock deadline.
A. layed
B. written
C. run
D. No change is necessary.
Cooper laid the 10-page paper on Professor
A
Cook’s desk; he had wrote the last sentence at
B
2:50 p.m., and then he ran across campus to
C
deliver the work by the 3 o’clock deadline.
A. layed
B. written
C. run
D. No change is necessary.
Cooper laid the 10-page paper on Professor
A
Cook’s desk; he had written the last sentence at
B
2:50 p.m., and then he ran across campus to
C
deliver the work by the 3 o’clock deadline.
A. layed
B. written
C. run
D. No change is necessary.
Item 8
We would have knowen that Dr. Carlson had
moved up the date of the quiz if we attended her
calculus class more frequently.
A. of knowen
B. have known
C. have knew
D. No change is necessary.
We would have knowen that Dr. Carlson had
moved up the date of the quiz if we attended her
calculus class more frequently.
A. of knowen
B. have known
C. have knew
D. No change is necessary.
We would have knowen that Dr. Carlson had
moved up the date of the quiz if we attended her
calculus class more frequently.
A. of knowen
B. have known
C. have knew
D. No change is necessary.
Item 9
Margaret breaked the cookie and gave half to
the young man stuck in the elevator with her; they
told stories to pass the time as mechanics
worked on the hydraulics.
A. broke
B. gived
C. telled
D. No change is necessary.
Margaret breaked the cookie and gave half to
A B
the young man stuck in the elevator with her; they
told stories to pass the time as mechanics
C
worked on the hydraulics.
A. broke
B. gived
C. telled
D. No change is necessary.
Margaret broke the cookie and gave half to
A B
the young man stuck in the elevator with her; they
told stories to pass the time as mechanics
C
worked on the hydraulics.
A. broke
B. gived
C. telled
D. No change is necessary.
Item 10
Meredith would have went to the concert, but
Gregory misplaced the tickets, which they still
haven’t found.
A. of went
B. have gone
C. have goed
D. No change is necessary.
Meredith would have went to the concert, but
Gregory misplaced the tickets, which they still
haven’t found.
A. of went
B. have gone
C. have goed
D. No change is necessary.
Meredith would have went to the concert, but
Gregory misplaced the tickets, which they still
haven’t found.
A. of went
B. have gone
C. have goed
D. No change is necessary.
Grammar Bytes!
provides additional
handouts and exercises on
irregular verb forms.
Go to
chompchomp.com!
The End.
Don’t let the
right verb
form get
away!

Weitere ähnliche Inhalte

Was ist angesagt?

Relative clauses
Relative clausesRelative clauses
Relative clauses
azkania
 
Sentences for dummies
Sentences for dummiesSentences for dummies
Sentences for dummies
gibb0
 
130 common mistakes_in_english
130 common mistakes_in_english130 common mistakes_in_english
130 common mistakes_in_english
yasmin ndunge
 

Was ist angesagt? (18)

Review Modals Should, Could, and Must with Practice
Review Modals Should, Could, and Must with PracticeReview Modals Should, Could, and Must with Practice
Review Modals Should, Could, and Must with Practice
 
General test 2 highter
 General test 2 highter General test 2 highter
General test 2 highter
 
Persuasive device quiz
Persuasive device quizPersuasive device quiz
Persuasive device quiz
 
Run ons & fragments
Run ons & fragmentsRun ons & fragments
Run ons & fragments
 
Common mistakes in english speaking or writing
Common mistakes in english speaking or writingCommon mistakes in english speaking or writing
Common mistakes in english speaking or writing
 
04 ic or dc bomb game
04 ic or dc bomb game04 ic or dc bomb game
04 ic or dc bomb game
 
Tense Shift
Tense ShiftTense Shift
Tense Shift
 
Relative clauses
Relative clausesRelative clauses
Relative clauses
 
Sentences for dummies
Sentences for dummiesSentences for dummies
Sentences for dummies
 
264 indep dep-clauses-c
264 indep dep-clauses-c264 indep dep-clauses-c
264 indep dep-clauses-c
 
Common errors 2
Common errors 2Common errors 2
Common errors 2
 
130 common mistakes_in_english
130 common mistakes_in_english130 common mistakes_in_english
130 common mistakes_in_english
 
Logic Q & A
Logic Q & ALogic Q & A
Logic Q & A
 
Taller preparatorio-icfes-inglc3a9s-convertido
Taller preparatorio-icfes-inglc3a9s-convertidoTaller preparatorio-icfes-inglc3a9s-convertido
Taller preparatorio-icfes-inglc3a9s-convertido
 
3 adverb of frequency 5 pages
3 adverb of frequency 5 pages3 adverb of frequency 5 pages
3 adverb of frequency 5 pages
 
Q&A Today
Q&A TodayQ&A Today
Q&A Today
 
Review Phrasal Verb Idioms
Review Phrasal Verb IdiomsReview Phrasal Verb Idioms
Review Phrasal Verb Idioms
 
The Essay: Thesis Pieces
The Essay: Thesis PiecesThe Essay: Thesis Pieces
The Essay: Thesis Pieces
 

Ähnlich wie Verb forms

verb forms regular and irregular for students
verb forms regular and irregular for studentsverb forms regular and irregular for students
verb forms regular and irregular for students
panacheacademy11
 

Ähnlich wie Verb forms (20)

verb forms regular and irregular for students
verb forms regular and irregular for studentsverb forms regular and irregular for students
verb forms regular and irregular for students
 
verbforms.pptIrregular verbshave no consistent patterns
verbforms.pptIrregular verbshave no consistent patternsverbforms.pptIrregular verbshave no consistent patterns
verbforms.pptIrregular verbshave no consistent patterns
 
verbforms.ppt
verbforms.pptverbforms.ppt
verbforms.ppt
 
Tenseshift
TenseshiftTenseshift
Tenseshift
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
Subject verb Agreement presentation for Students
Subject verb Agreement presentation for StudentsSubject verb Agreement presentation for Students
Subject verb Agreement presentation for Students
 
Verb forms
Verb formsVerb forms
Verb forms
 
fhcgvjblkhj.iouilkdcghvhhlksvagreement.ppt
fhcgvjblkhj.iouilkdcghvhhlksvagreement.pptfhcgvjblkhj.iouilkdcghvhhlksvagreement.ppt
fhcgvjblkhj.iouilkdcghvhhlksvagreement.ppt
 
spelling.ppt
spelling.pptspelling.ppt
spelling.ppt
 
spelling.ppt
spelling.pptspelling.ppt
spelling.ppt
 
Comma Splices, Run- On Sentences, and Fragments
Comma Splices, Run- On Sentences, and FragmentsComma Splices, Run- On Sentences, and Fragments
Comma Splices, Run- On Sentences, and Fragments
 
punctuation.ppt
punctuation.pptpunctuation.ppt
punctuation.ppt
 
Punctuation
PunctuationPunctuation
Punctuation
 
cs_fs_frag.pptx
cs_fs_frag.pptxcs_fs_frag.pptx
cs_fs_frag.pptx
 
coordinate_subordinate.ppt
coordinate_subordinate.pptcoordinate_subordinate.ppt
coordinate_subordinate.ppt
 
confusedwords.ppt
confusedwords.pptconfusedwords.ppt
confusedwords.ppt
 

Kürzlich hochgeladen

Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...
Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...
Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...
ZurliaSoop
 

Kürzlich hochgeladen (20)

How to Manage Global Discount in Odoo 17 POS
How to Manage Global Discount in Odoo 17 POSHow to Manage Global Discount in Odoo 17 POS
How to Manage Global Discount in Odoo 17 POS
 
80 ĐỀ THI THỬ TUYỂN SINH TIẾNG ANH VÀO 10 SỞ GD – ĐT THÀNH PHỐ HỒ CHÍ MINH NĂ...
80 ĐỀ THI THỬ TUYỂN SINH TIẾNG ANH VÀO 10 SỞ GD – ĐT THÀNH PHỐ HỒ CHÍ MINH NĂ...80 ĐỀ THI THỬ TUYỂN SINH TIẾNG ANH VÀO 10 SỞ GD – ĐT THÀNH PHỐ HỒ CHÍ MINH NĂ...
80 ĐỀ THI THỬ TUYỂN SINH TIẾNG ANH VÀO 10 SỞ GD – ĐT THÀNH PHỐ HỒ CHÍ MINH NĂ...
 
On National Teacher Day, meet the 2024-25 Kenan Fellows
On National Teacher Day, meet the 2024-25 Kenan FellowsOn National Teacher Day, meet the 2024-25 Kenan Fellows
On National Teacher Day, meet the 2024-25 Kenan Fellows
 
Sociology 101 Demonstration of Learning Exhibit
Sociology 101 Demonstration of Learning ExhibitSociology 101 Demonstration of Learning Exhibit
Sociology 101 Demonstration of Learning Exhibit
 
Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...
Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...
Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...
 
How to setup Pycharm environment for Odoo 17.pptx
How to setup Pycharm environment for Odoo 17.pptxHow to setup Pycharm environment for Odoo 17.pptx
How to setup Pycharm environment for Odoo 17.pptx
 
Unit 3 Emotional Intelligence and Spiritual Intelligence.pdf
Unit 3 Emotional Intelligence and Spiritual Intelligence.pdfUnit 3 Emotional Intelligence and Spiritual Intelligence.pdf
Unit 3 Emotional Intelligence and Spiritual Intelligence.pdf
 
On_Translating_a_Tamil_Poem_by_A_K_Ramanujan.pptx
On_Translating_a_Tamil_Poem_by_A_K_Ramanujan.pptxOn_Translating_a_Tamil_Poem_by_A_K_Ramanujan.pptx
On_Translating_a_Tamil_Poem_by_A_K_Ramanujan.pptx
 
How to Add New Custom Addons Path in Odoo 17
How to Add New Custom Addons Path in Odoo 17How to Add New Custom Addons Path in Odoo 17
How to Add New Custom Addons Path in Odoo 17
 
Graduate Outcomes Presentation Slides - English
Graduate Outcomes Presentation Slides - EnglishGraduate Outcomes Presentation Slides - English
Graduate Outcomes Presentation Slides - English
 
Basic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptxBasic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptx
 
Accessible Digital Futures project (20/03/2024)
Accessible Digital Futures project (20/03/2024)Accessible Digital Futures project (20/03/2024)
Accessible Digital Futures project (20/03/2024)
 
Single or Multiple melodic lines structure
Single or Multiple melodic lines structureSingle or Multiple melodic lines structure
Single or Multiple melodic lines structure
 
Understanding Accommodations and Modifications
Understanding  Accommodations and ModificationsUnderstanding  Accommodations and Modifications
Understanding Accommodations and Modifications
 
Fostering Friendships - Enhancing Social Bonds in the Classroom
Fostering Friendships - Enhancing Social Bonds  in the ClassroomFostering Friendships - Enhancing Social Bonds  in the Classroom
Fostering Friendships - Enhancing Social Bonds in the Classroom
 
Google Gemini An AI Revolution in Education.pptx
Google Gemini An AI Revolution in Education.pptxGoogle Gemini An AI Revolution in Education.pptx
Google Gemini An AI Revolution in Education.pptx
 
General Principles of Intellectual Property: Concepts of Intellectual Proper...
General Principles of Intellectual Property: Concepts of Intellectual  Proper...General Principles of Intellectual Property: Concepts of Intellectual  Proper...
General Principles of Intellectual Property: Concepts of Intellectual Proper...
 
How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17
 
Micro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdfMicro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdf
 
HMCS Max Bernays Pre-Deployment Brief (May 2024).pptx
HMCS Max Bernays Pre-Deployment Brief (May 2024).pptxHMCS Max Bernays Pre-Deployment Brief (May 2024).pptx
HMCS Max Bernays Pre-Deployment Brief (May 2024).pptx
 

Verb forms

  • 1. This presentation is brought to you by Grammar Bytes!, ©2019 by Robin L. Simmons.
  • 2. Verb Forms I know you can say hook , hooked ... But can you say took, tooked?
  • 3. This presentation covers the use of standard regular and irregular verb forms. A verb form item on an objective test might look like this ...
  • 4. Sample Item Thomas sang along until the CD ended; then as he was choosing a new disk, he lost control of the car and drived into a ditch. A. sung B. chosing C. drove D. No change is necessary. Thomas sang along until the CD ended; then as A he was choosing a new disk, he lost control of B the car and drived into a ditch. C A. sung B. chosing C. drove D. No change is necessary. Thomas sang along until the CD ended; then as A he was choosing a new disk, he lost control of B the car and drove into a ditch. C A. sung B. chosing C. drove D. No change is necessary. Is sang, choosing, or drived a badly formed verb? Drived is incorrect, which option C fixes.
  • 5. Regular verbs have reliable forms. Infinitive Simple Present Simple Past Past Participle Present Participle to laugh laugh(s) laughed laughed laughing to start start(s) started started starting to travel travel(s) traveled traveled traveling Or to fish, fish(es), fished, fished, fishing!
  • 6. Irregular verbs, however, have no consistent patterns. Infinitive Simple Present Simple Past Past Participle Present Participle to drive drive(s) drove driven driving to think think(s) thought thought thinking to drink drink(s) drank drunk drinking to swim swim(s) swam swum swimming For example, to catch, catch(es), caught, caught, catching!
  • 7. On many objective exams, you cannot use a dictionar y to look up the correct form! X
  • 8. When in doubt, rely on “gut” feelings. Hey, I’ve seen that verb before! Your eyes have seen in print—and your brain has registered—all of the possible verb forms that you will encounter for this skill. If you don’t recognize the right answer, go with the one that feels right.
  • 9. Instead of skipping class to go fishing, Yolanda should of studied for her accounting exam. Don’t confuse of and have. My grade was a disaster! Instead of skipping class to go fishing, Yolanda should have studied for her accounting exam.
  • 10. Confirm that used to is in the past tense. Now that he’s older, Fred has a full-time job, but he use to spend his summers fishing. You’re a bad influence! Now that he’s older, Fred has a full-time job, but he used to spend his summers fishing.
  • 11. Quick Test Directions: In the items that follow, choose the option that corrects an error in the underlined portion(s). If no error exists, choose “No change is necessary.” Show me what you know.
  • 12. Item 1 We knew that Charley had hid the cookies in his bedroom, so we stole his key and searched in all the dresser drawers. A. knowed B. hidden C. stealed D. No change is necessary. We knew that Charley had hid the cookies in A B his bedroom, so we stole his key and searched in C all the dresser drawers. A. knowed B. hidden C. stealed D. No change is necessary. We knew that Charley had hidden the cookies in A B his bedroom, so we stole his key and searched in C all the dresser drawers. A. knowed B. hidden C. stealed D. No change is necessary.
  • 13. Item 2 If we had known that you were serving squid eyeball stew, we would of come for dinner! A. of came B. have came C. have come D. No change is necessary. If we had known that you were serving squid eyeball stew, we would of come for dinner! A. of came B. have came C. have come D. No change is necessary. If we had known that you were serving squid eyeball stew, we would of come for dinner! A. of came B. have came C. have come D. No change is necessary.
  • 14. Item 3 Priscilla use to have a pet parakeet; her mother’s story is that the bird escaped and flew away, but Priscilla believes that the cat ate it. A. used B. flied C. eaten D. No change is necessary. Priscilla use to have a pet parakeet; her mother’s A story is that the bird escaped and flew away, but B Priscilla believes that the cat ate it. C A. used B. flied C. eaten D. No change is necessary. Priscilla used to have a pet parakeet; her mother’s A story is that the bird escaped and flew away, but B Priscilla believes that the cat ate it. C A. used B. flied C. eaten D. No change is necessary.
  • 15. Item 4 Julissa was soaked during the afternoon thunderstorm because she had choosed to walk to school rather than drive. A. chosen B. choosen C. chose D. No change is necessary. Julissa was soaked during the afternoon thunderstorm because she had choosed to walk to school rather than drive. A. chosen B. choosen C. chose D. No change is necessary. Julissa was soaked during the afternoon thunderstorm because she had choosed to walk to school rather than drive. A. chosen B. choosen C. chose D. No change is necessary.
  • 16. Item 5 James brung roses and begged forgiveness, but when Rhonda saw that her ex still hadn’t shaved his ridiculous mustache, she shut the door in his face. A. brought B. seen C. shutted D. No change is necessary. James brung roses and begged forgiveness, but A when Rhonda saw that her ex still hadn’t shaved B his ridiculous mustache, she shut the door in his C face. A. brought B. seen C. shutted D. No change is necessary. James brought roses and begged forgiveness, but A when Rhonda saw that her ex still hadn’t shaved B his ridiculous mustache, she shut the door in his C face. A. brought B. seen C. shutted D. No change is necessary.
  • 17. Item 6 If Toby had tooken Charlene’s advice, that bottle of soda wouldn’t have exploded all over the front of his new white shirt. A. took B. tooked C. taken D. No change is necessary. If Toby had tooken Charlene’s advice, that bottle of soda wouldn’t have exploded all over the front of his new white shirt. A. took B. tooked C. taken D. No change is necessary. If Toby had tooken Charlene’s advice, that bottle of soda wouldn’t have exploded all over the front of his new white shirt. A. took B. tooked C. taken D. No change is necessary.
  • 18. Item 7 Cooper laid the 10-page paper on Professor Cook’s desk; he had wrote the last sentence at 2:50 p.m., and then he ran across campus to deliver the work by the 3 o’clock deadline. A. layed B. written C. run D. No change is necessary. Cooper laid the 10-page paper on Professor A Cook’s desk; he had wrote the last sentence at B 2:50 p.m., and then he ran across campus to C deliver the work by the 3 o’clock deadline. A. layed B. written C. run D. No change is necessary. Cooper laid the 10-page paper on Professor A Cook’s desk; he had written the last sentence at B 2:50 p.m., and then he ran across campus to C deliver the work by the 3 o’clock deadline. A. layed B. written C. run D. No change is necessary.
  • 19. Item 8 We would have knowen that Dr. Carlson had moved up the date of the quiz if we attended her calculus class more frequently. A. of knowen B. have known C. have knew D. No change is necessary. We would have knowen that Dr. Carlson had moved up the date of the quiz if we attended her calculus class more frequently. A. of knowen B. have known C. have knew D. No change is necessary. We would have knowen that Dr. Carlson had moved up the date of the quiz if we attended her calculus class more frequently. A. of knowen B. have known C. have knew D. No change is necessary.
  • 20. Item 9 Margaret breaked the cookie and gave half to the young man stuck in the elevator with her; they told stories to pass the time as mechanics worked on the hydraulics. A. broke B. gived C. telled D. No change is necessary. Margaret breaked the cookie and gave half to A B the young man stuck in the elevator with her; they told stories to pass the time as mechanics C worked on the hydraulics. A. broke B. gived C. telled D. No change is necessary. Margaret broke the cookie and gave half to A B the young man stuck in the elevator with her; they told stories to pass the time as mechanics C worked on the hydraulics. A. broke B. gived C. telled D. No change is necessary.
  • 21. Item 10 Meredith would have went to the concert, but Gregory misplaced the tickets, which they still haven’t found. A. of went B. have gone C. have goed D. No change is necessary. Meredith would have went to the concert, but Gregory misplaced the tickets, which they still haven’t found. A. of went B. have gone C. have goed D. No change is necessary. Meredith would have went to the concert, but Gregory misplaced the tickets, which they still haven’t found. A. of went B. have gone C. have goed D. No change is necessary.
  • 22. Grammar Bytes! provides additional handouts and exercises on irregular verb forms. Go to chompchomp.com!
  • 23. The End. Don’t let the right verb form get away!