SlideShare ist ein Scribd-Unternehmen logo
1 von 11
Copyright © 2017 W. W. Norton & Company
Contemporary World
Literature
Volume F
Resistance and Rebellion
This era of history is marked by resistance movements
that reacted to harsh governmental systems or
policies that restricted human rights.
The 1968 student rebellions in Prague, Paris, and
Mexico City, and elsewhere served as an ignition of
the spark for people’s movements to protest the
Vietnam War in the United States, to call for the
destruction of the Berlin Wall and all that it
symbolized to East and West Germany and around the
world, to undo apartheid policies that legislated
segregation in South Africa, and to rebel against the
communist ruling of the People’s Republic of China, a
rebellion that ended with a massacre in Tiananmen
Square. Nelson Mandela
Globalization, Migration, and Cultural Hybridity
The years since World War II
have been an era of
globalization in investment,
knowledge, politics and culture.
The political upheavals of the
twentieth century created
millions of refugees and
entrenched conflicts. Today the
world is one of increased
migration, in which the
movements of people have
created dialogue—and often
conflict—over cultural hybridity.
Syrian refugees
Epidemics
• New epidemics, particularly AIDS,
ravaged populations in the West and
broadly in Africa. In Europe and North
America, AIDS first affected mostly
homosexuals.
• The decimation of gay communities by
the disease led to more militant forms
of activism, which built on anti-
discrimination efforts dating back to the
Stonewall uprising in the United States
and other activist movements around
the world.
• UNAIDS reports that in 2016, almost 37
million people were living with HIV. Its
goal is to end the epidemic by 2030
through education and other
prevention methods.
AIDS awareness billboard in Africa
Gay Rights around the World
Patrons of the Stonewall, a popular
gay bar in the Greenwich Village
neighborhood of New York City, and
their supporters resisted arrest in
June 1969, marking a watershed
moment in the world’s global gay
rights movements.
Another result of the gay rights
movement was the introduction of
same-sex marriage legislation in
countries around the world.
Homosexual writers have more
voice within global literatures,
though many authors are still
persecuted or are in danger. LGBT community members and allies rallying at a pride parade
in Madurai, 2017
Feminisms and Feminist Activism
• Feminist activism and thought affected much of the
twentieth century. From gains in women’s suffrage to
workplace rights to reproductive freedoms, feminists taught
the world about issues of gender inequity implicit in laws,
households, and educational settings.
• In the 1980s, many feminists began to see the importance
of intersectionality, a term coined by Kimberlé Crenshaw.
Further, many feminists began to talk more about the
intersections of gender, race, and class oppression and
worked toward ending all oppression—not just the
oppression of white women, a critique of many Second
Wave feminists.
• More current feminist practice considers the challenges of
rigid gender norms on all people, especially on those in the
transgender community.
• The Women’s March in 2017 is emblematic of new thinking
about gender and the ways feminists approach resistance to
oppression.
intersectional feminist icons Gloria Steinem and Maya
Angelou marching together
Characteristics of Contemporary Literature
(some, one, or all these elements might be found in contemporary literature-difficult period to
label)
1. Emphasis on an even more accurate picture of society.
2. Nationalism- possible emphasis on country, loyalty, etc.
3. Possible ambiguity in theme, contents, character, and plot.
4. More experimental use of dialogue. Possible play with language, inclusion of dialects,
more profane usage, etc.
5. Ambiguous chronology; time sequence disconnected or vague.
6. Prevalence of multicultural themes-awareness of different ethnic, sexual, and cultural
identities.
7. Increasing specific historical reference.
Diverse Voices
• With the cultural hybridity that attends the movement of peoples and the sharing of information,
nostalgia for tradition and the past is heightened.
• Writers are conscious of having an audience beyond their nation or region and even beyond their
language.
• Diverse literatures chronicle a variety of experiences and create empathy and connection.
• The twenty-first century began with reminders of the interconnectedness of a global society linked
by industrial capitalism and communications technology but divided by institutions such as religion or
politics.
• While war, poverty, oppression, and poverty are events that divide us, world literatures that share
diverse experiences can unite us through the experience of reading.
Magical Realism
Magical realism draws on the realist tradition of the historical novel and the nightmarish worlds of
writers like Kafka.
Writers including Marquéz, Fuentes, Allende, Morrison, and Rushdie combine realistic historical
narration with fanciful folktales.
These works have the greatest impact in zones of uneven economic development, where educated
writers have incorporated the folk wisdom of their rural, sometimes illiterate communities.
Postmodernism
• Texts question the boundary between fiction
and history
• Distortions of historical reality
• Unreliable narrators
This concludes the Lecture PowerPoint presentation for
The Norton Anthology
of World Literature

Weitere ähnliche Inhalte

Was ist angesagt?

African Writers
African WritersAfrican Writers
African WritersNhala Grace
 
EL 117 Contemporary Popular Literature Prelim Module 1.pdf
EL 117 Contemporary Popular Literature Prelim Module 1.pdfEL 117 Contemporary Popular Literature Prelim Module 1.pdf
EL 117 Contemporary Popular Literature Prelim Module 1.pdfRojelJanOcampoGalzot
 
Stailistiks ppt
Stailistiks pptStailistiks ppt
Stailistiks pptNavera Rahman
 
SURVEY OF PHILIPPINE LITERATURE REVIEWER_073502.docx
SURVEY OF PHILIPPINE LITERATURE REVIEWER_073502.docxSURVEY OF PHILIPPINE LITERATURE REVIEWER_073502.docx
SURVEY OF PHILIPPINE LITERATURE REVIEWER_073502.docxChlaireGongora
 
History of American Literature
History of American LiteratureHistory of American Literature
History of American LiteratureKhim Dela Cruz
 
Contemporary literature features
Contemporary literature featuresContemporary literature features
Contemporary literature featurestotaaalupiii
 
Major Periods in English and American Literature
Major Periods in English and American LiteratureMajor Periods in English and American Literature
Major Periods in English and American LiteratureJesullyna Manuel
 
Myth mythology and folklore
Myth mythology and folkloreMyth mythology and folklore
Myth mythology and folkloreRichardBanez
 
Literature during the American Revolution
Literature during the American RevolutionLiterature during the American Revolution
Literature during the American RevolutionVictoria Arthur
 
Approaches to teaching literature in efl classrooms
Approaches to teaching literature in efl classroomsApproaches to teaching literature in efl classrooms
Approaches to teaching literature in efl classroomsAprilianty Wid
 
Children s literature
Children s literatureChildren s literature
Children s literatureALISHAANN
 
Philippine literature. Grade 7-English Curriculum
Philippine literature. Grade 7-English CurriculumPhilippine literature. Grade 7-English Curriculum
Philippine literature. Grade 7-English CurriculumBacood Elementary School
 
Arabian literature
Arabian literatureArabian literature
Arabian literatureGenevieve Oh
 
Introduction to american literature
Introduction to american literatureIntroduction to american literature
Introduction to american literatureSamantha Eujay Saprid
 
Teaching grammar
Teaching grammarTeaching grammar
Teaching grammarMontse Irun
 
Language learning materials development
Language learning materials developmentLanguage learning materials development
Language learning materials developmentlelybasir
 
Issues in Children's Literature
Issues in Children's LiteratureIssues in Children's Literature
Issues in Children's LiteratureJovy Elimanao - Mihm
 
Literature Testing
Literature TestingLiterature Testing
Literature TestingAlexa Chan
 
Children & Adolescent Literature
Children & Adolescent LiteratureChildren & Adolescent Literature
Children & Adolescent LiteratureSherwin Daquioag
 

Was ist angesagt? (20)

African Writers
African WritersAfrican Writers
African Writers
 
EL 117 Contemporary Popular Literature Prelim Module 1.pdf
EL 117 Contemporary Popular Literature Prelim Module 1.pdfEL 117 Contemporary Popular Literature Prelim Module 1.pdf
EL 117 Contemporary Popular Literature Prelim Module 1.pdf
 
Stailistiks ppt
Stailistiks pptStailistiks ppt
Stailistiks ppt
 
SURVEY OF PHILIPPINE LITERATURE REVIEWER_073502.docx
SURVEY OF PHILIPPINE LITERATURE REVIEWER_073502.docxSURVEY OF PHILIPPINE LITERATURE REVIEWER_073502.docx
SURVEY OF PHILIPPINE LITERATURE REVIEWER_073502.docx
 
History of American Literature
History of American LiteratureHistory of American Literature
History of American Literature
 
Contemporary literature features
Contemporary literature featuresContemporary literature features
Contemporary literature features
 
Major Periods in English and American Literature
Major Periods in English and American LiteratureMajor Periods in English and American Literature
Major Periods in English and American Literature
 
Myth mythology and folklore
Myth mythology and folkloreMyth mythology and folklore
Myth mythology and folklore
 
Literature during the American Revolution
Literature during the American RevolutionLiterature during the American Revolution
Literature during the American Revolution
 
Approaches to teaching literature in efl classrooms
Approaches to teaching literature in efl classroomsApproaches to teaching literature in efl classrooms
Approaches to teaching literature in efl classrooms
 
Children s literature
Children s literatureChildren s literature
Children s literature
 
Philippine literature. Grade 7-English Curriculum
Philippine literature. Grade 7-English CurriculumPhilippine literature. Grade 7-English Curriculum
Philippine literature. Grade 7-English Curriculum
 
Arabian literature
Arabian literatureArabian literature
Arabian literature
 
Introduction to american literature
Introduction to american literatureIntroduction to american literature
Introduction to american literature
 
Teaching grammar
Teaching grammarTeaching grammar
Teaching grammar
 
The Restoration And The 18th Century
The Restoration And The 18th CenturyThe Restoration And The 18th Century
The Restoration And The 18th Century
 
Language learning materials development
Language learning materials developmentLanguage learning materials development
Language learning materials development
 
Issues in Children's Literature
Issues in Children's LiteratureIssues in Children's Literature
Issues in Children's Literature
 
Literature Testing
Literature TestingLiterature Testing
Literature Testing
 
Children & Adolescent Literature
Children & Adolescent LiteratureChildren & Adolescent Literature
Children & Adolescent Literature
 

Ă„hnlich wie Resistance and Rebellion in Contemporary Literature

Etnocentrismo
EtnocentrismoEtnocentrismo
EtnocentrismoPaulo Arieu
 
ferneeamericancivilwar.pdf
ferneeamericancivilwar.pdfferneeamericancivilwar.pdf
ferneeamericancivilwar.pdfKanikaBansal52
 
Untitled_(4).pdf
Untitled_(4).pdfUntitled_(4).pdf
Untitled_(4).pdfRebeccaLowe33
 
Social protest movements
Social protest movementsSocial protest movements
Social protest movementsvishnugud
 
GrobalRaciality-Preface+Intro.pdfGlobal RacialityG.docx
GrobalRaciality-Preface+Intro.pdfGlobal RacialityG.docxGrobalRaciality-Preface+Intro.pdfGlobal RacialityG.docx
GrobalRaciality-Preface+Intro.pdfGlobal RacialityG.docxshericehewat
 
50th anniversary Lasa - Latin American Studies conference
50th anniversary Lasa - Latin American Studies conference50th anniversary Lasa - Latin American Studies conference
50th anniversary Lasa - Latin American Studies conferenceCarolina Matos
 
Martin luther king biography - Christine Tsamili
Martin luther king biography - Christine TsamiliMartin luther king biography - Christine Tsamili
Martin luther king biography - Christine TsamiliAnaxagoreio
 
CLASH_OF_CIVILIZATIONS 2.ppt
CLASH_OF_CIVILIZATIONS 2.pptCLASH_OF_CIVILIZATIONS 2.ppt
CLASH_OF_CIVILIZATIONS 2.pptFarahElgendy
 
HY 1020, Western Civilization II 1 UNIT IV STUDY GUIDE .docx
HY 1020, Western Civilization II 1 UNIT IV STUDY GUIDE .docxHY 1020, Western Civilization II 1 UNIT IV STUDY GUIDE .docx
HY 1020, Western Civilization II 1 UNIT IV STUDY GUIDE .docxwilcockiris
 
Sixties Cultural Changes
Sixties Cultural ChangesSixties Cultural Changes
Sixties Cultural ChangesLaura Arrigo
 
Different factors affected twentieth century novel
Different factors affected twentieth century novelDifferent factors affected twentieth century novel
Different factors affected twentieth century novelMesho1414
 
The role of media in development
The role of media in developmentThe role of media in development
The role of media in developmentdean dundas
 
2Ethnographic Research about the Popular CultureSummaryInt.docx
2Ethnographic Research about the Popular CultureSummaryInt.docx2Ethnographic Research about the Popular CultureSummaryInt.docx
2Ethnographic Research about the Popular CultureSummaryInt.docxtarifarmarie
 

Ă„hnlich wie Resistance and Rebellion in Contemporary Literature (15)

Etnocentrismo
EtnocentrismoEtnocentrismo
Etnocentrismo
 
ferneeamericancivilwar.pdf
ferneeamericancivilwar.pdfferneeamericancivilwar.pdf
ferneeamericancivilwar.pdf
 
Untitled_(4).pdf
Untitled_(4).pdfUntitled_(4).pdf
Untitled_(4).pdf
 
Social protest movements
Social protest movementsSocial protest movements
Social protest movements
 
GrobalRaciality-Preface+Intro.pdfGlobal RacialityG.docx
GrobalRaciality-Preface+Intro.pdfGlobal RacialityG.docxGrobalRaciality-Preface+Intro.pdfGlobal RacialityG.docx
GrobalRaciality-Preface+Intro.pdfGlobal RacialityG.docx
 
50th anniversary Lasa - Latin American Studies conference
50th anniversary Lasa - Latin American Studies conference50th anniversary Lasa - Latin American Studies conference
50th anniversary Lasa - Latin American Studies conference
 
Martin luther king biography - Christine Tsamili
Martin luther king biography - Christine TsamiliMartin luther king biography - Christine Tsamili
Martin luther king biography - Christine Tsamili
 
CLASH_OF_CIVILIZATIONS 2.ppt
CLASH_OF_CIVILIZATIONS 2.pptCLASH_OF_CIVILIZATIONS 2.ppt
CLASH_OF_CIVILIZATIONS 2.ppt
 
Hook For Essays
Hook For EssaysHook For Essays
Hook For Essays
 
HY 1020, Western Civilization II 1 UNIT IV STUDY GUIDE .docx
HY 1020, Western Civilization II 1 UNIT IV STUDY GUIDE .docxHY 1020, Western Civilization II 1 UNIT IV STUDY GUIDE .docx
HY 1020, Western Civilization II 1 UNIT IV STUDY GUIDE .docx
 
Sixties Cultural Changes
Sixties Cultural ChangesSixties Cultural Changes
Sixties Cultural Changes
 
Hybrid cultures,
Hybrid cultures,Hybrid cultures,
Hybrid cultures,
 
Different factors affected twentieth century novel
Different factors affected twentieth century novelDifferent factors affected twentieth century novel
Different factors affected twentieth century novel
 
The role of media in development
The role of media in developmentThe role of media in development
The role of media in development
 
2Ethnographic Research about the Popular CultureSummaryInt.docx
2Ethnographic Research about the Popular CultureSummaryInt.docx2Ethnographic Research about the Popular CultureSummaryInt.docx
2Ethnographic Research about the Popular CultureSummaryInt.docx
 

Mehr von Crowder College

Logical Fallacies Slide Show
Logical Fallacies Slide Show Logical Fallacies Slide Show
Logical Fallacies Slide Show Crowder College
 
Rhyme Scheme, Rhythm, and Meter
Rhyme Scheme, Rhythm, and Meter Rhyme Scheme, Rhythm, and Meter
Rhyme Scheme, Rhythm, and Meter Crowder College
 
Rhyme Scheme, Rhythm, and Meter
Rhyme Scheme, Rhythm, and Meter Rhyme Scheme, Rhythm, and Meter
Rhyme Scheme, Rhythm, and Meter Crowder College
 
Plot in Literature
Plot in LiteraturePlot in Literature
Plot in LiteratureCrowder College
 
Introduction to Modernism
Introduction to ModernismIntroduction to Modernism
Introduction to ModernismCrowder College
 
An Introduction to Henrik Ibsen
An Introduction to Henrik IbsenAn Introduction to Henrik Ibsen
An Introduction to Henrik IbsenCrowder College
 
Introduction to Rabindranath Tagore
Introduction to Rabindranath Tagore   Introduction to Rabindranath Tagore
Introduction to Rabindranath Tagore Crowder College
 
Poetry Analysis Basics
Poetry Analysis BasicsPoetry Analysis Basics
Poetry Analysis BasicsCrowder College
 
Introduction to Petrarch
Introduction to PetrarchIntroduction to Petrarch
Introduction to PetrarchCrowder College
 
The Hero's Journey
The Hero's JourneyThe Hero's Journey
The Hero's JourneyCrowder College
 
Introduction to Beowulf
Introduction to BeowulfIntroduction to Beowulf
Introduction to BeowulfCrowder College
 
Europe and the New World
Europe and the New WorldEurope and the New World
Europe and the New WorldCrowder College
 
Petrarch and the Love Lyric
Petrarch and the Love LyricPetrarch and the Love Lyric
Petrarch and the Love LyricCrowder College
 
Sophocles: Oedipus Rex
Sophocles: Oedipus RexSophocles: Oedipus Rex
Sophocles: Oedipus RexCrowder College
 
Blended Learning at Crowder College
Blended Learning at Crowder CollegeBlended Learning at Crowder College
Blended Learning at Crowder CollegeCrowder College
 

Mehr von Crowder College (20)

Logical Fallacies Slide Show
Logical Fallacies Slide Show Logical Fallacies Slide Show
Logical Fallacies Slide Show
 
Goethe
GoetheGoethe
Goethe
 
Rhyme Scheme, Rhythm, and Meter
Rhyme Scheme, Rhythm, and Meter Rhyme Scheme, Rhythm, and Meter
Rhyme Scheme, Rhythm, and Meter
 
Rhyme Scheme, Rhythm, and Meter
Rhyme Scheme, Rhythm, and Meter Rhyme Scheme, Rhythm, and Meter
Rhyme Scheme, Rhythm, and Meter
 
Plot in Literature
Plot in LiteraturePlot in Literature
Plot in Literature
 
Introduction to Modernism
Introduction to ModernismIntroduction to Modernism
Introduction to Modernism
 
An Introduction to Henrik Ibsen
An Introduction to Henrik IbsenAn Introduction to Henrik Ibsen
An Introduction to Henrik Ibsen
 
Leo Tolstoy
Leo Tolstoy Leo Tolstoy
Leo Tolstoy
 
Introduction to Rabindranath Tagore
Introduction to Rabindranath Tagore   Introduction to Rabindranath Tagore
Introduction to Rabindranath Tagore
 
Poetry Analysis Basics
Poetry Analysis BasicsPoetry Analysis Basics
Poetry Analysis Basics
 
Introduction to Petrarch
Introduction to PetrarchIntroduction to Petrarch
Introduction to Petrarch
 
The Hero's Journey
The Hero's JourneyThe Hero's Journey
The Hero's Journey
 
Introduction to Beowulf
Introduction to BeowulfIntroduction to Beowulf
Introduction to Beowulf
 
Europe and the New World
Europe and the New WorldEurope and the New World
Europe and the New World
 
Petrarch and the Love Lyric
Petrarch and the Love LyricPetrarch and the Love Lyric
Petrarch and the Love Lyric
 
Humanism
HumanismHumanism
Humanism
 
Sophocles: Oedipus Rex
Sophocles: Oedipus RexSophocles: Oedipus Rex
Sophocles: Oedipus Rex
 
The Hero
The HeroThe Hero
The Hero
 
Poetry and Meter
Poetry and MeterPoetry and Meter
Poetry and Meter
 
Blended Learning at Crowder College
Blended Learning at Crowder CollegeBlended Learning at Crowder College
Blended Learning at Crowder College
 

KĂĽrzlich hochgeladen

Roles & Responsibilities in Pharmacovigilance
Roles & Responsibilities in PharmacovigilanceRoles & Responsibilities in Pharmacovigilance
Roles & Responsibilities in PharmacovigilanceSamikshaHamane
 
Judging the Relevance and worth of ideas part 2.pptx
Judging the Relevance  and worth of ideas part 2.pptxJudging the Relevance  and worth of ideas part 2.pptx
Judging the Relevance and worth of ideas part 2.pptxSherlyMaeNeri
 
Q4 English4 Week3 PPT Melcnmg-based.pptx
Q4 English4 Week3 PPT Melcnmg-based.pptxQ4 English4 Week3 PPT Melcnmg-based.pptx
Q4 English4 Week3 PPT Melcnmg-based.pptxnelietumpap1
 
Barangay Council for the Protection of Children (BCPC) Orientation.pptx
Barangay Council for the Protection of Children (BCPC) Orientation.pptxBarangay Council for the Protection of Children (BCPC) Orientation.pptx
Barangay Council for the Protection of Children (BCPC) Orientation.pptxCarlos105
 
GRADE 4 - SUMMATIVE TEST QUARTER 4 ALL SUBJECTS
GRADE 4 - SUMMATIVE TEST QUARTER 4 ALL SUBJECTSGRADE 4 - SUMMATIVE TEST QUARTER 4 ALL SUBJECTS
GRADE 4 - SUMMATIVE TEST QUARTER 4 ALL SUBJECTSJoshuaGantuangco2
 
THEORIES OF ORGANIZATION-PUBLIC ADMINISTRATION
THEORIES OF ORGANIZATION-PUBLIC ADMINISTRATIONTHEORIES OF ORGANIZATION-PUBLIC ADMINISTRATION
THEORIES OF ORGANIZATION-PUBLIC ADMINISTRATIONHumphrey A Beña
 
Choosing the Right CBSE School A Comprehensive Guide for Parents
Choosing the Right CBSE School A Comprehensive Guide for ParentsChoosing the Right CBSE School A Comprehensive Guide for Parents
Choosing the Right CBSE School A Comprehensive Guide for Parentsnavabharathschool99
 
How to Add Barcode on PDF Report in Odoo 17
How to Add Barcode on PDF Report in Odoo 17How to Add Barcode on PDF Report in Odoo 17
How to Add Barcode on PDF Report in Odoo 17Celine George
 
Like-prefer-love -hate+verb+ing & silent letters & citizenship text.pdf
Like-prefer-love -hate+verb+ing & silent letters & citizenship text.pdfLike-prefer-love -hate+verb+ing & silent letters & citizenship text.pdf
Like-prefer-love -hate+verb+ing & silent letters & citizenship text.pdfMr Bounab Samir
 
Earth Day Presentation wow hello nice great
Earth Day Presentation wow hello nice greatEarth Day Presentation wow hello nice great
Earth Day Presentation wow hello nice greatYousafMalik24
 
4.18.24 Movement Legacies, Reflection, and Review.pptx
4.18.24 Movement Legacies, Reflection, and Review.pptx4.18.24 Movement Legacies, Reflection, and Review.pptx
4.18.24 Movement Legacies, Reflection, and Review.pptxmary850239
 
Incoming and Outgoing Shipments in 3 STEPS Using Odoo 17
Incoming and Outgoing Shipments in 3 STEPS Using Odoo 17Incoming and Outgoing Shipments in 3 STEPS Using Odoo 17
Incoming and Outgoing Shipments in 3 STEPS Using Odoo 17Celine George
 
How to do quick user assign in kanban in Odoo 17 ERP
How to do quick user assign in kanban in Odoo 17 ERPHow to do quick user assign in kanban in Odoo 17 ERP
How to do quick user assign in kanban in Odoo 17 ERPCeline George
 
DATA STRUCTURE AND ALGORITHM for beginners
DATA STRUCTURE AND ALGORITHM for beginnersDATA STRUCTURE AND ALGORITHM for beginners
DATA STRUCTURE AND ALGORITHM for beginnersSabitha Banu
 
Gas measurement O2,Co2,& ph) 04/2024.pptx
Gas measurement O2,Co2,& ph) 04/2024.pptxGas measurement O2,Co2,& ph) 04/2024.pptx
Gas measurement O2,Co2,& ph) 04/2024.pptxDr.Ibrahim Hassaan
 
Full Stack Web Development Course for Beginners
Full Stack Web Development Course  for BeginnersFull Stack Web Development Course  for Beginners
Full Stack Web Development Course for BeginnersSabitha Banu
 
What is Model Inheritance in Odoo 17 ERP
What is Model Inheritance in Odoo 17 ERPWhat is Model Inheritance in Odoo 17 ERP
What is Model Inheritance in Odoo 17 ERPCeline George
 
Procuring digital preservation CAN be quick and painless with our new dynamic...
Procuring digital preservation CAN be quick and painless with our new dynamic...Procuring digital preservation CAN be quick and painless with our new dynamic...
Procuring digital preservation CAN be quick and painless with our new dynamic...Jisc
 
call girls in Kamla Market (DELHI) 🔝 >༒9953330565🔝 genuine Escort Service 🔝✔️✔️
call girls in Kamla Market (DELHI) 🔝 >༒9953330565🔝 genuine Escort Service 🔝✔️✔️call girls in Kamla Market (DELHI) 🔝 >༒9953330565🔝 genuine Escort Service 🔝✔️✔️
call girls in Kamla Market (DELHI) 🔝 >༒9953330565🔝 genuine Escort Service 🔝✔️✔️9953056974 Low Rate Call Girls In Saket, Delhi NCR
 

KĂĽrzlich hochgeladen (20)

OS-operating systems- ch04 (Threads) ...
OS-operating systems- ch04 (Threads) ...OS-operating systems- ch04 (Threads) ...
OS-operating systems- ch04 (Threads) ...
 
Roles & Responsibilities in Pharmacovigilance
Roles & Responsibilities in PharmacovigilanceRoles & Responsibilities in Pharmacovigilance
Roles & Responsibilities in Pharmacovigilance
 
Judging the Relevance and worth of ideas part 2.pptx
Judging the Relevance  and worth of ideas part 2.pptxJudging the Relevance  and worth of ideas part 2.pptx
Judging the Relevance and worth of ideas part 2.pptx
 
Q4 English4 Week3 PPT Melcnmg-based.pptx
Q4 English4 Week3 PPT Melcnmg-based.pptxQ4 English4 Week3 PPT Melcnmg-based.pptx
Q4 English4 Week3 PPT Melcnmg-based.pptx
 
Barangay Council for the Protection of Children (BCPC) Orientation.pptx
Barangay Council for the Protection of Children (BCPC) Orientation.pptxBarangay Council for the Protection of Children (BCPC) Orientation.pptx
Barangay Council for the Protection of Children (BCPC) Orientation.pptx
 
GRADE 4 - SUMMATIVE TEST QUARTER 4 ALL SUBJECTS
GRADE 4 - SUMMATIVE TEST QUARTER 4 ALL SUBJECTSGRADE 4 - SUMMATIVE TEST QUARTER 4 ALL SUBJECTS
GRADE 4 - SUMMATIVE TEST QUARTER 4 ALL SUBJECTS
 
THEORIES OF ORGANIZATION-PUBLIC ADMINISTRATION
THEORIES OF ORGANIZATION-PUBLIC ADMINISTRATIONTHEORIES OF ORGANIZATION-PUBLIC ADMINISTRATION
THEORIES OF ORGANIZATION-PUBLIC ADMINISTRATION
 
Choosing the Right CBSE School A Comprehensive Guide for Parents
Choosing the Right CBSE School A Comprehensive Guide for ParentsChoosing the Right CBSE School A Comprehensive Guide for Parents
Choosing the Right CBSE School A Comprehensive Guide for Parents
 
How to Add Barcode on PDF Report in Odoo 17
How to Add Barcode on PDF Report in Odoo 17How to Add Barcode on PDF Report in Odoo 17
How to Add Barcode on PDF Report in Odoo 17
 
Like-prefer-love -hate+verb+ing & silent letters & citizenship text.pdf
Like-prefer-love -hate+verb+ing & silent letters & citizenship text.pdfLike-prefer-love -hate+verb+ing & silent letters & citizenship text.pdf
Like-prefer-love -hate+verb+ing & silent letters & citizenship text.pdf
 
Earth Day Presentation wow hello nice great
Earth Day Presentation wow hello nice greatEarth Day Presentation wow hello nice great
Earth Day Presentation wow hello nice great
 
4.18.24 Movement Legacies, Reflection, and Review.pptx
4.18.24 Movement Legacies, Reflection, and Review.pptx4.18.24 Movement Legacies, Reflection, and Review.pptx
4.18.24 Movement Legacies, Reflection, and Review.pptx
 
Incoming and Outgoing Shipments in 3 STEPS Using Odoo 17
Incoming and Outgoing Shipments in 3 STEPS Using Odoo 17Incoming and Outgoing Shipments in 3 STEPS Using Odoo 17
Incoming and Outgoing Shipments in 3 STEPS Using Odoo 17
 
How to do quick user assign in kanban in Odoo 17 ERP
How to do quick user assign in kanban in Odoo 17 ERPHow to do quick user assign in kanban in Odoo 17 ERP
How to do quick user assign in kanban in Odoo 17 ERP
 
DATA STRUCTURE AND ALGORITHM for beginners
DATA STRUCTURE AND ALGORITHM for beginnersDATA STRUCTURE AND ALGORITHM for beginners
DATA STRUCTURE AND ALGORITHM for beginners
 
Gas measurement O2,Co2,& ph) 04/2024.pptx
Gas measurement O2,Co2,& ph) 04/2024.pptxGas measurement O2,Co2,& ph) 04/2024.pptx
Gas measurement O2,Co2,& ph) 04/2024.pptx
 
Full Stack Web Development Course for Beginners
Full Stack Web Development Course  for BeginnersFull Stack Web Development Course  for Beginners
Full Stack Web Development Course for Beginners
 
What is Model Inheritance in Odoo 17 ERP
What is Model Inheritance in Odoo 17 ERPWhat is Model Inheritance in Odoo 17 ERP
What is Model Inheritance in Odoo 17 ERP
 
Procuring digital preservation CAN be quick and painless with our new dynamic...
Procuring digital preservation CAN be quick and painless with our new dynamic...Procuring digital preservation CAN be quick and painless with our new dynamic...
Procuring digital preservation CAN be quick and painless with our new dynamic...
 
call girls in Kamla Market (DELHI) 🔝 >༒9953330565🔝 genuine Escort Service 🔝✔️✔️
call girls in Kamla Market (DELHI) 🔝 >༒9953330565🔝 genuine Escort Service 🔝✔️✔️call girls in Kamla Market (DELHI) 🔝 >༒9953330565🔝 genuine Escort Service 🔝✔️✔️
call girls in Kamla Market (DELHI) 🔝 >༒9953330565🔝 genuine Escort Service 🔝✔️✔️
 

Resistance and Rebellion in Contemporary Literature

  • 1. Copyright © 2017 W. W. Norton & Company Contemporary World Literature Volume F
  • 2. Resistance and Rebellion This era of history is marked by resistance movements that reacted to harsh governmental systems or policies that restricted human rights. The 1968 student rebellions in Prague, Paris, and Mexico City, and elsewhere served as an ignition of the spark for people’s movements to protest the Vietnam War in the United States, to call for the destruction of the Berlin Wall and all that it symbolized to East and West Germany and around the world, to undo apartheid policies that legislated segregation in South Africa, and to rebel against the communist ruling of the People’s Republic of China, a rebellion that ended with a massacre in Tiananmen Square. Nelson Mandela
  • 3. Globalization, Migration, and Cultural Hybridity The years since World War II have been an era of globalization in investment, knowledge, politics and culture. The political upheavals of the twentieth century created millions of refugees and entrenched conflicts. Today the world is one of increased migration, in which the movements of people have created dialogue—and often conflict—over cultural hybridity. Syrian refugees
  • 4. Epidemics • New epidemics, particularly AIDS, ravaged populations in the West and broadly in Africa. In Europe and North America, AIDS first affected mostly homosexuals. • The decimation of gay communities by the disease led to more militant forms of activism, which built on anti- discrimination efforts dating back to the Stonewall uprising in the United States and other activist movements around the world. • UNAIDS reports that in 2016, almost 37 million people were living with HIV. Its goal is to end the epidemic by 2030 through education and other prevention methods. AIDS awareness billboard in Africa
  • 5. Gay Rights around the World Patrons of the Stonewall, a popular gay bar in the Greenwich Village neighborhood of New York City, and their supporters resisted arrest in June 1969, marking a watershed moment in the world’s global gay rights movements. Another result of the gay rights movement was the introduction of same-sex marriage legislation in countries around the world. Homosexual writers have more voice within global literatures, though many authors are still persecuted or are in danger. LGBT community members and allies rallying at a pride parade in Madurai, 2017
  • 6. Feminisms and Feminist Activism • Feminist activism and thought affected much of the twentieth century. From gains in women’s suffrage to workplace rights to reproductive freedoms, feminists taught the world about issues of gender inequity implicit in laws, households, and educational settings. • In the 1980s, many feminists began to see the importance of intersectionality, a term coined by KimberlĂ© Crenshaw. Further, many feminists began to talk more about the intersections of gender, race, and class oppression and worked toward ending all oppression—not just the oppression of white women, a critique of many Second Wave feminists. • More current feminist practice considers the challenges of rigid gender norms on all people, especially on those in the transgender community. • The Women’s March in 2017 is emblematic of new thinking about gender and the ways feminists approach resistance to oppression. intersectional feminist icons Gloria Steinem and Maya Angelou marching together
  • 7. Characteristics of Contemporary Literature (some, one, or all these elements might be found in contemporary literature-difficult period to label) 1. Emphasis on an even more accurate picture of society. 2. Nationalism- possible emphasis on country, loyalty, etc. 3. Possible ambiguity in theme, contents, character, and plot. 4. More experimental use of dialogue. Possible play with language, inclusion of dialects, more profane usage, etc. 5. Ambiguous chronology; time sequence disconnected or vague. 6. Prevalence of multicultural themes-awareness of different ethnic, sexual, and cultural identities. 7. Increasing specific historical reference.
  • 8. Diverse Voices • With the cultural hybridity that attends the movement of peoples and the sharing of information, nostalgia for tradition and the past is heightened. • Writers are conscious of having an audience beyond their nation or region and even beyond their language. • Diverse literatures chronicle a variety of experiences and create empathy and connection. • The twenty-first century began with reminders of the interconnectedness of a global society linked by industrial capitalism and communications technology but divided by institutions such as religion or politics. • While war, poverty, oppression, and poverty are events that divide us, world literatures that share diverse experiences can unite us through the experience of reading.
  • 9. Magical Realism Magical realism draws on the realist tradition of the historical novel and the nightmarish worlds of writers like Kafka. Writers including MarquĂ©z, Fuentes, Allende, Morrison, and Rushdie combine realistic historical narration with fanciful folktales. These works have the greatest impact in zones of uneven economic development, where educated writers have incorporated the folk wisdom of their rural, sometimes illiterate communities.
  • 10. Postmodernism • Texts question the boundary between fiction and history • Distortions of historical reality • Unreliable narrators
  • 11. This concludes the Lecture PowerPoint presentation for The Norton Anthology of World Literature

Hinweis der Redaktion

  1. This era of history is marked by resistance movements that reacted to harsh governmental systems or policies that restricted human rights. The 1968 student rebellions in Prague, Paris, and Mexico City, and elsewhere served as an ignition of the spark for people’s movements to protest the Vietnam War in the United States, to call for the destruction of the Berlin Wall and all that it symbolized to East and West Germany and around the world, to undo apartheid policies that legislated segregation in South Africa, and to rebel against the communist ruling of the People’s Republic of China, a rebellion that ended with a massacre in Tiananmen Square. The image is a photograph of Nelson Mandela in traditional garb. Apic/RETIRED/Getty Images
  2. The years since World War II have been an era of globalization in investment, knowledge, politics and culture. The political upheavals of the twentieth century created millions of refugees and entrenched conflicts. Today the world is one of increased migration, in which the movements of people have created dialogue—and often conflict—over cultural hybridity. The image shows a boat filled with Syrian refugees. Yannis Kolesidis/Epa/REX/Shutterstock
  3. New epidemics, particularly AIDS, ravaged populations in the West and broadly in Africa. In Europe and North America, AIDS first affected mostly homosexuals. The decimation of gay communities by the disease led to more militant forms of activism, which built on antidiscrimination efforts dating back to the Stonewall uprising in the United States and other activist movements around the world. UNAIDS reports that in 2016, almost 37 million people were living with HIV. Its goal is to end the epidemic by 2030 through education and other prevention methods. The image is a photograph of an AIDS awareness billboard in Africa. ImagesBROKER/REX/Shutterstock
  4. Patrons of the Stonewall, a popular gay bar in the Greenwich Village neighborhood of New York City, and their supporters resisted arrest in June 1969, marking a watershed moment in the world’s global gay rights movements. Another result of the gay rights movement was the introduction of same-sex marriage legislation in countries around the world. Queer writers have more voice within global literatures, though many authors are still persecuted or are in danger. The image shows LGBT community members and allies rallying at a pride parade in Madurai, 2017. Sanjeev Gupta/EPA/Shutterstock
  5. Feminist activism and thought affected much of the twentieth century. From gains in women’s suffrage to workplace rights to reproductive freedoms, feminists taught the world about issues of gender inequity implicit in laws, households, and educational settings. In the 1980s, many feminists began to see the importance of intersectionality, a term coined by Kimberlé Crenshaw. Further, many feminists began to talk more about the intersections of gender, race, and class oppression and worked toward ending all oppression—not just the oppression of white women, a critique of many Second Wave feminists. More current feminist practice considers the challenges of rigid gender norms on all people, especially on those in the transgender community. The Women’s March in 2017 is emblematic of new thinking about gender and the ways feminists approach resistance to oppression. The image shows intersectional feminist icons Gloria Steinem and Maya Angelou marching together. James M. Thresher/The Washington Post/Getty Images
  6. With the cultural hybridity that attends the movement of peoples and the sharing of information, nostalgia for tradition and the past is heightened. Writers are conscious of having an audience beyond their nation or region and even beyond their language. Diverse literatures chronicle a variety of experiences and create empathy and connection. The twenty-first century began with reminders of the interconnectedness of a global society linked by industrial capitalism and communications technology but divided by institutions such as religion or politics. While war, poverty, oppression, and poverty are events that divide us, world literatures that share diverse experiences can unite us through the experience of reading.
  7. Magical realism draws on the realist tradition of the historical novel and the nightmarish worlds of writers like Kafka. Writers including Marquéz, Fuentes, Allende, Morrison, and Rushdie combine realistic historical narration with fanciful folktales. These works have the greatest impact in zones of uneven economic development, where educated writers have incorporated the folk wisdom of their rural, sometimes illiterate communities.
  8. Postmodernists such as Bolaño, Coetzee, and Pamuk call attention to the fictionality of their reconstruction of those events, encouraging the reader to keep in mind that stories are the creations of writers who may, by the very act of narration, distort historical reality.