SlideShare ist ein Scribd-Unternehmen logo
1 von 16
Bioinformatics represents a new, growing area of
science that uses computational approaches to
answer biological questions.
•Use computer technologies and statistical methods
•Manage and analyze a huge volume of biological data
Correlated subjects
Biology
Biochemistry
Molecular Biology
Microbiology
Genetic engineering
Mathematics
Statistics
Computer science.
Biological ProblemBiological Problem
Statistical/ Mathematical
Solution
Computer Program
Bioinformatics
Software/ Tools
Biological data
Result 3
Test Candidate Result
in Wet Lab
Final Solution with
Laboratory Proof
Final Solution with
Laboratory Proof
+
Result 2
Result 1
Approximate Result
Analyze huge volume of data
Don’t need expensive wet lab
Same research can be repeated many times
No adverse effect
Time saving
Understanding Sequence Formats
An example of a multiple sequence FASTA file
>SEQUENCE_1
MTEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAK
KADRLAAEGVSVKVSDDFTIAAMRPSYLSYEDLDMTFVENEYKALVAELEKE
NEERRRLKDPNKPEHKQFASRKQLSDAILKEAEEKIKEELKAQGKPEKIWDNII
PGKMNSFIADNSQLDSKLTLMGQFYVMDDKKTVEQVIAEKEKEFGGKIKIVEF
ICFEVGEGLEKKTEDFAAEVAAQL
>SEQUENCE_2
SATVSEINSETDFVAKNDQFIALTKDTTAHIQSNSLQSVEELHSSTINGVKFEE
YLKSQIATIGENLVVRRFATLKAGANGVVNGYIHTNGRVGVVIAAACDSAEVA
SKSRDLLRQICMH
Fasta sequence always start with this sign
Fasta sequence will always have a sequence header
GenBank
gi|gi-number|gb|accession|locus
EMBL Data Library
gi|gi-number|emb|accession|locus
DDBJ, DNA Database of Japan
gi|gi-number|dbj|accession|locus
Sequence Header Example from Various Sequence Database
NBRF PIR
pir||entry P
Protein Research Foundation
prf||name
SWISS-PROT
sp|accession|name Brookhaven
Protein Data Bank
(1) pdb|entry|chain Brookhaven Protein Data Bank
(2) entry:chain|PDBID|CHAIN|SEQUENCE Patents pat|country|number
GenInfo Backbone
Id bbs|number
General database identifier
gnl|database|identifier
NCBI Reference Sequence
ref|accession|locus
Local Sequence identifier
lcl|identifier
Some More Example
Fasta File Extensions &Meaning
Extension Meaning Notes
fasta (.fas) generic fasta
Any generic fasta file. Other extensions
can be fa, seq, fsa
fna fasta nucleic acid Used to generically specify nucleic acids.
ffn FASTA nucleotide coding regions Contains coding regions for a genome.
faa fasta amino acid
Contains amino acids. A multiple protein
fasta file can have the more specific
extension mpfa.
frn FASTA non-coding RNA
Contains non-coding RNA regions for a
genome, in DNA alphabet e.g. tRNA,
rRNA
File extension
There is no standard file extension for a text file containing FASTA formatted sequences. The table
below shows each extension and its respective meaning.
Take a look to NCBI Nucleotide database
Uniprot Protein Database Showing Link to Download Sequence in Fasta Format

Weitere ähnliche Inhalte

Was ist angesagt?

Lockhart art analys upload
Lockhart art analys uploadLockhart art analys upload
Lockhart art analys uploadbrucelockhart
 
Resume of Matthew P Weber
Resume of Matthew P WeberResume of Matthew P Weber
Resume of Matthew P WeberMatt Weber
 
Work Package Presentation
Work Package PresentationWork Package Presentation
Work Package Presentationlaurensrietveld
 
Predicting the Response to Hepatitis C Therapy
Predicting the Response to Hepatitis C TherapyPredicting the Response to Hepatitis C Therapy
Predicting the Response to Hepatitis C TherapySimone Romano
 
Annual environment and health conference 2018 sean lyons esri sl data-works...
Annual environment and health conference 2018 sean lyons esri   sl data-works...Annual environment and health conference 2018 sean lyons esri   sl data-works...
Annual environment and health conference 2018 sean lyons esri sl data-works...Environmental Protection Agency, Ireland
 
Field technology training for undergraduates
Field technology training for undergraduatesField technology training for undergraduates
Field technology training for undergraduatesfieldwork_ntf
 
Improving surveillance and early detection of Foot-and-mouth And Similar Tran...
Improving surveillance and early detection of Foot-and-mouth And Similar Tran...Improving surveillance and early detection of Foot-and-mouth And Similar Tran...
Improving surveillance and early detection of Foot-and-mouth And Similar Tran...EuFMD
 
Pragmatic Challenges in the Evaluation of Interactive Visualization Systems.
Pragmatic Challenges in the Evaluation of Interactive Visualization Systems.Pragmatic Challenges in the Evaluation of Interactive Visualization Systems.
Pragmatic Challenges in the Evaluation of Interactive Visualization Systems.BELIV Workshop
 
PERICLES workshop (IDCC 2016) - Appraisal
PERICLES workshop (IDCC 2016) - AppraisalPERICLES workshop (IDCC 2016) - Appraisal
PERICLES workshop (IDCC 2016) - AppraisalPERICLES_FP7
 
PERICLES workshop (IDCC 2016) - Policy and Quality Assurance in the Data Cont...
PERICLES workshop (IDCC 2016) - Policy and Quality Assurance in the Data Cont...PERICLES workshop (IDCC 2016) - Policy and Quality Assurance in the Data Cont...
PERICLES workshop (IDCC 2016) - Policy and Quality Assurance in the Data Cont...PERICLES_FP7
 
Scientific Method Notes
Scientific Method NotesScientific Method Notes
Scientific Method Notesmgitterm
 

Was ist angesagt? (12)

Lockhart art analys upload
Lockhart art analys uploadLockhart art analys upload
Lockhart art analys upload
 
Resume of Matthew P Weber
Resume of Matthew P WeberResume of Matthew P Weber
Resume of Matthew P Weber
 
Work Package Presentation
Work Package PresentationWork Package Presentation
Work Package Presentation
 
Predicting the Response to Hepatitis C Therapy
Predicting the Response to Hepatitis C TherapyPredicting the Response to Hepatitis C Therapy
Predicting the Response to Hepatitis C Therapy
 
Annual environment and health conference 2018 sean lyons esri sl data-works...
Annual environment and health conference 2018 sean lyons esri   sl data-works...Annual environment and health conference 2018 sean lyons esri   sl data-works...
Annual environment and health conference 2018 sean lyons esri sl data-works...
 
Field technology training for undergraduates
Field technology training for undergraduatesField technology training for undergraduates
Field technology training for undergraduates
 
Improving surveillance and early detection of Foot-and-mouth And Similar Tran...
Improving surveillance and early detection of Foot-and-mouth And Similar Tran...Improving surveillance and early detection of Foot-and-mouth And Similar Tran...
Improving surveillance and early detection of Foot-and-mouth And Similar Tran...
 
Pragmatic Challenges in the Evaluation of Interactive Visualization Systems.
Pragmatic Challenges in the Evaluation of Interactive Visualization Systems.Pragmatic Challenges in the Evaluation of Interactive Visualization Systems.
Pragmatic Challenges in the Evaluation of Interactive Visualization Systems.
 
Triton
Triton Triton
Triton
 
PERICLES workshop (IDCC 2016) - Appraisal
PERICLES workshop (IDCC 2016) - AppraisalPERICLES workshop (IDCC 2016) - Appraisal
PERICLES workshop (IDCC 2016) - Appraisal
 
PERICLES workshop (IDCC 2016) - Policy and Quality Assurance in the Data Cont...
PERICLES workshop (IDCC 2016) - Policy and Quality Assurance in the Data Cont...PERICLES workshop (IDCC 2016) - Policy and Quality Assurance in the Data Cont...
PERICLES workshop (IDCC 2016) - Policy and Quality Assurance in the Data Cont...
 
Scientific Method Notes
Scientific Method NotesScientific Method Notes
Scientific Method Notes
 

Andere mochten auch (20)

Planning a healthy diet
Planning a healthy dietPlanning a healthy diet
Planning a healthy diet
 
A healthy sporting diet
A healthy sporting dietA healthy sporting diet
A healthy sporting diet
 
Chapter 2 NUTR
Chapter 2 NUTRChapter 2 NUTR
Chapter 2 NUTR
 
K8 bs pa islam
K8 bs pa   islamK8 bs pa   islam
K8 bs pa islam
 
Sequence file formats
Sequence file formatsSequence file formats
Sequence file formats
 
Fasta
FastaFasta
Fasta
 
Blast
BlastBlast
Blast
 
BLAST (Basic local alignment search Tool)
BLAST (Basic local alignment search Tool)BLAST (Basic local alignment search Tool)
BLAST (Basic local alignment search Tool)
 
Fasta
FastaFasta
Fasta
 
The nurse’s role in keeping patients nourished
The nurse’s role in keeping patients nourished The nurse’s role in keeping patients nourished
The nurse’s role in keeping patients nourished
 
BIOLOGICAL SEQUENCE DATABASES
BIOLOGICAL SEQUENCE DATABASES BIOLOGICAL SEQUENCE DATABASES
BIOLOGICAL SEQUENCE DATABASES
 
Sequence Alignment,Blast, Fasta, MSA
Sequence Alignment,Blast, Fasta, MSASequence Alignment,Blast, Fasta, MSA
Sequence Alignment,Blast, Fasta, MSA
 
Basic Local Alignment Search Tool (BLAST)
Basic Local Alignment Search Tool (BLAST)Basic Local Alignment Search Tool (BLAST)
Basic Local Alignment Search Tool (BLAST)
 
Fasta
FastaFasta
Fasta
 
BLAST and sequence alignment
BLAST and sequence alignmentBLAST and sequence alignment
BLAST and sequence alignment
 
BLAST(Basic Local Alignment Tool)
BLAST(Basic Local Alignment Tool)BLAST(Basic Local Alignment Tool)
BLAST(Basic Local Alignment Tool)
 
Blast fasta 4
Blast fasta 4Blast fasta 4
Blast fasta 4
 
Biological databases
Biological databasesBiological databases
Biological databases
 
8 nutrition - nursing
8 nutrition - nursing8 nutrition - nursing
8 nutrition - nursing
 
Nutritional needs
Nutritional needsNutritional needs
Nutritional needs
 

Ähnlich wie Fasta file extensions & meaning

AS/A2 AQA Biology and Human Biology
AS/A2 AQA Biology and Human BiologyAS/A2 AQA Biology and Human Biology
AS/A2 AQA Biology and Human BiologyTeachersFirst
 
Impact of Sample Handling and Processing on Bioanalycial Outcome
Impact of Sample Handling and Processing on Bioanalycial OutcomeImpact of Sample Handling and Processing on Bioanalycial Outcome
Impact of Sample Handling and Processing on Bioanalycial OutcomeSGS
 
FRCPath-Examinations-in-Clinical-Biochemistry-Dr-Ruth-Ayling.pptx
FRCPath-Examinations-in-Clinical-Biochemistry-Dr-Ruth-Ayling.pptxFRCPath-Examinations-in-Clinical-Biochemistry-Dr-Ruth-Ayling.pptx
FRCPath-Examinations-in-Clinical-Biochemistry-Dr-Ruth-Ayling.pptxConstance39
 
Reproducible research: theory
Reproducible research: theoryReproducible research: theory
Reproducible research: theoryC. Tobin Magle
 
Experimental Design for Chronic Telemetry Studies
Experimental Design for Chronic Telemetry StudiesExperimental Design for Chronic Telemetry Studies
Experimental Design for Chronic Telemetry StudiesScintica Instrumentation
 
Minimizing Risk In Phase II and III Sample Size Calculation
Minimizing Risk In Phase II and III Sample Size CalculationMinimizing Risk In Phase II and III Sample Size Calculation
Minimizing Risk In Phase II and III Sample Size CalculationnQuery
 
The ELIXIR UK industry survey by Gabriella Rustici
The ELIXIR UK industry survey by Gabriella RusticiThe ELIXIR UK industry survey by Gabriella Rustici
The ELIXIR UK industry survey by Gabriella RusticiELIXIR UK
 
Power and sample size calculations for survival analysis webinar Slides
Power and sample size calculations for survival analysis webinar SlidesPower and sample size calculations for survival analysis webinar Slides
Power and sample size calculations for survival analysis webinar SlidesnQuery
 
Omics Logic - Bioinformatics 2.0
Omics Logic - Bioinformatics 2.0Omics Logic - Bioinformatics 2.0
Omics Logic - Bioinformatics 2.0Elia Brodsky
 
Experimental Design Considerations to Optimize Chronic Cardiovascular Telemet...
Experimental Design Considerations to Optimize Chronic Cardiovascular Telemet...Experimental Design Considerations to Optimize Chronic Cardiovascular Telemet...
Experimental Design Considerations to Optimize Chronic Cardiovascular Telemet...InsideScientific
 
Organochlorine Pesticides in Fruits & Vegetables
Organochlorine Pesticides in Fruits & Vegetables Organochlorine Pesticides in Fruits & Vegetables
Organochlorine Pesticides in Fruits & Vegetables v2zq
 
Towards Task Analysis Tool Support
Towards Task Analysis Tool SupportTowards Task Analysis Tool Support
Towards Task Analysis Tool SupportSuzanne Kieffer
 
Modeling Biomass Pile Management
Modeling Biomass Pile Management Modeling Biomass Pile Management
Modeling Biomass Pile Management Wasim Faizal
 
chapter-00-01.ppt analytical chemistry for college
chapter-00-01.ppt analytical chemistry for collegechapter-00-01.ppt analytical chemistry for college
chapter-00-01.ppt analytical chemistry for collegejoygalero
 
High Performance Computing and the Opportunity with Cognitive Technology
 High Performance Computing and the Opportunity with Cognitive Technology High Performance Computing and the Opportunity with Cognitive Technology
High Performance Computing and the Opportunity with Cognitive TechnologyIBM Watson
 
Scientific method notes updated aug2014
Scientific method notes   updated aug2014Scientific method notes   updated aug2014
Scientific method notes updated aug2014mszeron
 
Computational of Bioinformatics
Computational of BioinformaticsComputational of Bioinformatics
Computational of Bioinformaticsijtsrd
 

Ähnlich wie Fasta file extensions & meaning (20)

Bioinformatics
BioinformaticsBioinformatics
Bioinformatics
 
Bsl catalog
Bsl catalogBsl catalog
Bsl catalog
 
AS/A2 AQA Biology and Human Biology
AS/A2 AQA Biology and Human BiologyAS/A2 AQA Biology and Human Biology
AS/A2 AQA Biology and Human Biology
 
Impact of Sample Handling and Processing on Bioanalycial Outcome
Impact of Sample Handling and Processing on Bioanalycial OutcomeImpact of Sample Handling and Processing on Bioanalycial Outcome
Impact of Sample Handling and Processing on Bioanalycial Outcome
 
FRCPath-Examinations-in-Clinical-Biochemistry-Dr-Ruth-Ayling.pptx
FRCPath-Examinations-in-Clinical-Biochemistry-Dr-Ruth-Ayling.pptxFRCPath-Examinations-in-Clinical-Biochemistry-Dr-Ruth-Ayling.pptx
FRCPath-Examinations-in-Clinical-Biochemistry-Dr-Ruth-Ayling.pptx
 
Reproducible research: theory
Reproducible research: theoryReproducible research: theory
Reproducible research: theory
 
Experimental Design for Chronic Telemetry Studies
Experimental Design for Chronic Telemetry StudiesExperimental Design for Chronic Telemetry Studies
Experimental Design for Chronic Telemetry Studies
 
Minimizing Risk In Phase II and III Sample Size Calculation
Minimizing Risk In Phase II and III Sample Size CalculationMinimizing Risk In Phase II and III Sample Size Calculation
Minimizing Risk In Phase II and III Sample Size Calculation
 
The ELIXIR UK industry survey by Gabriella Rustici
The ELIXIR UK industry survey by Gabriella RusticiThe ELIXIR UK industry survey by Gabriella Rustici
The ELIXIR UK industry survey by Gabriella Rustici
 
Power and sample size calculations for survival analysis webinar Slides
Power and sample size calculations for survival analysis webinar SlidesPower and sample size calculations for survival analysis webinar Slides
Power and sample size calculations for survival analysis webinar Slides
 
Resume 2016 detailed
Resume 2016 detailedResume 2016 detailed
Resume 2016 detailed
 
Omics Logic - Bioinformatics 2.0
Omics Logic - Bioinformatics 2.0Omics Logic - Bioinformatics 2.0
Omics Logic - Bioinformatics 2.0
 
Experimental Design Considerations to Optimize Chronic Cardiovascular Telemet...
Experimental Design Considerations to Optimize Chronic Cardiovascular Telemet...Experimental Design Considerations to Optimize Chronic Cardiovascular Telemet...
Experimental Design Considerations to Optimize Chronic Cardiovascular Telemet...
 
Organochlorine Pesticides in Fruits & Vegetables
Organochlorine Pesticides in Fruits & Vegetables Organochlorine Pesticides in Fruits & Vegetables
Organochlorine Pesticides in Fruits & Vegetables
 
Towards Task Analysis Tool Support
Towards Task Analysis Tool SupportTowards Task Analysis Tool Support
Towards Task Analysis Tool Support
 
Modeling Biomass Pile Management
Modeling Biomass Pile Management Modeling Biomass Pile Management
Modeling Biomass Pile Management
 
chapter-00-01.ppt analytical chemistry for college
chapter-00-01.ppt analytical chemistry for collegechapter-00-01.ppt analytical chemistry for college
chapter-00-01.ppt analytical chemistry for college
 
High Performance Computing and the Opportunity with Cognitive Technology
 High Performance Computing and the Opportunity with Cognitive Technology High Performance Computing and the Opportunity with Cognitive Technology
High Performance Computing and the Opportunity with Cognitive Technology
 
Scientific method notes updated aug2014
Scientific method notes   updated aug2014Scientific method notes   updated aug2014
Scientific method notes updated aug2014
 
Computational of Bioinformatics
Computational of BioinformaticsComputational of Bioinformatics
Computational of Bioinformatics
 

Mehr von Atai Rabby

Identification of the positively selected genes governing host-pathogen arm r...
Identification of the positively selected genes governing host-pathogen arm r...Identification of the positively selected genes governing host-pathogen arm r...
Identification of the positively selected genes governing host-pathogen arm r...Atai Rabby
 
D4476, a cell-permeant inhibitor of CK1, potentiates the action of Bromodeoxy...
D4476, a cell-permeant inhibitor of CK1, potentiates the action of Bromodeoxy...D4476, a cell-permeant inhibitor of CK1, potentiates the action of Bromodeoxy...
D4476, a cell-permeant inhibitor of CK1, potentiates the action of Bromodeoxy...Atai Rabby
 
Identifying Antibiotics posing potential Health Risk: Microbial Resistance Sc...
Identifying Antibiotics posing potential Health Risk: Microbial Resistance Sc...Identifying Antibiotics posing potential Health Risk: Microbial Resistance Sc...
Identifying Antibiotics posing potential Health Risk: Microbial Resistance Sc...Atai Rabby
 
Quantative Structure-Activity Relationships (QSAR)
Quantative Structure-Activity Relationships (QSAR)Quantative Structure-Activity Relationships (QSAR)
Quantative Structure-Activity Relationships (QSAR)Atai Rabby
 
Antiviral drug
Antiviral drugAntiviral drug
Antiviral drugAtai Rabby
 
Actin, Myosin, and Cell Movement
Actin, Myosin, and Cell MovementActin, Myosin, and Cell Movement
Actin, Myosin, and Cell MovementAtai Rabby
 
Thyroid hormone
Thyroid hormoneThyroid hormone
Thyroid hormoneAtai Rabby
 
Parathyroid hormone
Parathyroid hormoneParathyroid hormone
Parathyroid hormoneAtai Rabby
 
Gonadal hormone
Gonadal hormoneGonadal hormone
Gonadal hormoneAtai Rabby
 
Adrenal hormone
Adrenal hormoneAdrenal hormone
Adrenal hormoneAtai Rabby
 
Bioinformatics practical note
Bioinformatics practical noteBioinformatics practical note
Bioinformatics practical noteAtai Rabby
 
Rice dna extraction miniprep protocol
Rice dna extraction miniprep protocolRice dna extraction miniprep protocol
Rice dna extraction miniprep protocolAtai Rabby
 
Restriction mapping of bacterial dna
Restriction mapping of bacterial dnaRestriction mapping of bacterial dna
Restriction mapping of bacterial dnaAtai Rabby
 
Mesurement of cretinine kinase from blood of a cardiac patient
Mesurement of cretinine kinase from blood of a cardiac patientMesurement of cretinine kinase from blood of a cardiac patient
Mesurement of cretinine kinase from blood of a cardiac patientAtai Rabby
 
How the blast work
How the blast workHow the blast work
How the blast workAtai Rabby
 
The biochemistry of memory
The biochemistry of memoryThe biochemistry of memory
The biochemistry of memoryAtai Rabby
 
Transmission of nerve impulses
Transmission of nerve impulsesTransmission of nerve impulses
Transmission of nerve impulsesAtai Rabby
 

Mehr von Atai Rabby (20)

Immunoassay
ImmunoassayImmunoassay
Immunoassay
 
Identification of the positively selected genes governing host-pathogen arm r...
Identification of the positively selected genes governing host-pathogen arm r...Identification of the positively selected genes governing host-pathogen arm r...
Identification of the positively selected genes governing host-pathogen arm r...
 
D4476, a cell-permeant inhibitor of CK1, potentiates the action of Bromodeoxy...
D4476, a cell-permeant inhibitor of CK1, potentiates the action of Bromodeoxy...D4476, a cell-permeant inhibitor of CK1, potentiates the action of Bromodeoxy...
D4476, a cell-permeant inhibitor of CK1, potentiates the action of Bromodeoxy...
 
Identifying Antibiotics posing potential Health Risk: Microbial Resistance Sc...
Identifying Antibiotics posing potential Health Risk: Microbial Resistance Sc...Identifying Antibiotics posing potential Health Risk: Microbial Resistance Sc...
Identifying Antibiotics posing potential Health Risk: Microbial Resistance Sc...
 
Quantative Structure-Activity Relationships (QSAR)
Quantative Structure-Activity Relationships (QSAR)Quantative Structure-Activity Relationships (QSAR)
Quantative Structure-Activity Relationships (QSAR)
 
Antiviral drug
Antiviral drugAntiviral drug
Antiviral drug
 
Real-Time PCR
Real-Time PCRReal-Time PCR
Real-Time PCR
 
Actin, Myosin, and Cell Movement
Actin, Myosin, and Cell MovementActin, Myosin, and Cell Movement
Actin, Myosin, and Cell Movement
 
Thyroid hormone
Thyroid hormoneThyroid hormone
Thyroid hormone
 
Parathyroid hormone
Parathyroid hormoneParathyroid hormone
Parathyroid hormone
 
Gonadal hormone
Gonadal hormoneGonadal hormone
Gonadal hormone
 
Gi hormone
Gi hormoneGi hormone
Gi hormone
 
Adrenal hormone
Adrenal hormoneAdrenal hormone
Adrenal hormone
 
Bioinformatics practical note
Bioinformatics practical noteBioinformatics practical note
Bioinformatics practical note
 
Rice dna extraction miniprep protocol
Rice dna extraction miniprep protocolRice dna extraction miniprep protocol
Rice dna extraction miniprep protocol
 
Restriction mapping of bacterial dna
Restriction mapping of bacterial dnaRestriction mapping of bacterial dna
Restriction mapping of bacterial dna
 
Mesurement of cretinine kinase from blood of a cardiac patient
Mesurement of cretinine kinase from blood of a cardiac patientMesurement of cretinine kinase from blood of a cardiac patient
Mesurement of cretinine kinase from blood of a cardiac patient
 
How the blast work
How the blast workHow the blast work
How the blast work
 
The biochemistry of memory
The biochemistry of memoryThe biochemistry of memory
The biochemistry of memory
 
Transmission of nerve impulses
Transmission of nerve impulsesTransmission of nerve impulses
Transmission of nerve impulses
 

Kürzlich hochgeladen

Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024
Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024
Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024Victor Rentea
 
Rising Above_ Dubai Floods and the Fortitude of Dubai International Airport.pdf
Rising Above_ Dubai Floods and the Fortitude of Dubai International Airport.pdfRising Above_ Dubai Floods and the Fortitude of Dubai International Airport.pdf
Rising Above_ Dubai Floods and the Fortitude of Dubai International Airport.pdfOrbitshub
 
ICT role in 21st century education and its challenges
ICT role in 21st century education and its challengesICT role in 21st century education and its challenges
ICT role in 21st century education and its challengesrafiqahmad00786416
 
Platformless Horizons for Digital Adaptability
Platformless Horizons for Digital AdaptabilityPlatformless Horizons for Digital Adaptability
Platformless Horizons for Digital AdaptabilityWSO2
 
Why Teams call analytics are critical to your entire business
Why Teams call analytics are critical to your entire businessWhy Teams call analytics are critical to your entire business
Why Teams call analytics are critical to your entire businesspanagenda
 
Connector Corner: Accelerate revenue generation using UiPath API-centric busi...
Connector Corner: Accelerate revenue generation using UiPath API-centric busi...Connector Corner: Accelerate revenue generation using UiPath API-centric busi...
Connector Corner: Accelerate revenue generation using UiPath API-centric busi...DianaGray10
 
Biography Of Angeliki Cooney | Senior Vice President Life Sciences | Albany, ...
Biography Of Angeliki Cooney | Senior Vice President Life Sciences | Albany, ...Biography Of Angeliki Cooney | Senior Vice President Life Sciences | Albany, ...
Biography Of Angeliki Cooney | Senior Vice President Life Sciences | Albany, ...Angeliki Cooney
 
AWS Community Day CPH - Three problems of Terraform
AWS Community Day CPH - Three problems of TerraformAWS Community Day CPH - Three problems of Terraform
AWS Community Day CPH - Three problems of TerraformAndrey Devyatkin
 
Strategize a Smooth Tenant-to-tenant Migration and Copilot Takeoff
Strategize a Smooth Tenant-to-tenant Migration and Copilot TakeoffStrategize a Smooth Tenant-to-tenant Migration and Copilot Takeoff
Strategize a Smooth Tenant-to-tenant Migration and Copilot Takeoffsammart93
 
CNIC Information System with Pakdata Cf In Pakistan
CNIC Information System with Pakdata Cf In PakistanCNIC Information System with Pakdata Cf In Pakistan
CNIC Information System with Pakdata Cf In Pakistandanishmna97
 
Introduction to Multilingual Retrieval Augmented Generation (RAG)
Introduction to Multilingual Retrieval Augmented Generation (RAG)Introduction to Multilingual Retrieval Augmented Generation (RAG)
Introduction to Multilingual Retrieval Augmented Generation (RAG)Zilliz
 
EMPOWERMENT TECHNOLOGY GRADE 11 QUARTER 2 REVIEWER
EMPOWERMENT TECHNOLOGY GRADE 11 QUARTER 2 REVIEWEREMPOWERMENT TECHNOLOGY GRADE 11 QUARTER 2 REVIEWER
EMPOWERMENT TECHNOLOGY GRADE 11 QUARTER 2 REVIEWERMadyBayot
 
TrustArc Webinar - Unlock the Power of AI-Driven Data Discovery
TrustArc Webinar - Unlock the Power of AI-Driven Data DiscoveryTrustArc Webinar - Unlock the Power of AI-Driven Data Discovery
TrustArc Webinar - Unlock the Power of AI-Driven Data DiscoveryTrustArc
 
Artificial Intelligence Chap.5 : Uncertainty
Artificial Intelligence Chap.5 : UncertaintyArtificial Intelligence Chap.5 : Uncertainty
Artificial Intelligence Chap.5 : UncertaintyKhushali Kathiriya
 
DBX First Quarter 2024 Investor Presentation
DBX First Quarter 2024 Investor PresentationDBX First Quarter 2024 Investor Presentation
DBX First Quarter 2024 Investor PresentationDropbox
 
WSO2's API Vision: Unifying Control, Empowering Developers
WSO2's API Vision: Unifying Control, Empowering DevelopersWSO2's API Vision: Unifying Control, Empowering Developers
WSO2's API Vision: Unifying Control, Empowering DevelopersWSO2
 
Boost Fertility New Invention Ups Success Rates.pdf
Boost Fertility New Invention Ups Success Rates.pdfBoost Fertility New Invention Ups Success Rates.pdf
Boost Fertility New Invention Ups Success Rates.pdfsudhanshuwaghmare1
 
Six Myths about Ontologies: The Basics of Formal Ontology
Six Myths about Ontologies: The Basics of Formal OntologySix Myths about Ontologies: The Basics of Formal Ontology
Six Myths about Ontologies: The Basics of Formal Ontologyjohnbeverley2021
 

Kürzlich hochgeladen (20)

Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024
Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024
Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024
 
Rising Above_ Dubai Floods and the Fortitude of Dubai International Airport.pdf
Rising Above_ Dubai Floods and the Fortitude of Dubai International Airport.pdfRising Above_ Dubai Floods and the Fortitude of Dubai International Airport.pdf
Rising Above_ Dubai Floods and the Fortitude of Dubai International Airport.pdf
 
ICT role in 21st century education and its challenges
ICT role in 21st century education and its challengesICT role in 21st century education and its challenges
ICT role in 21st century education and its challenges
 
Platformless Horizons for Digital Adaptability
Platformless Horizons for Digital AdaptabilityPlatformless Horizons for Digital Adaptability
Platformless Horizons for Digital Adaptability
 
Why Teams call analytics are critical to your entire business
Why Teams call analytics are critical to your entire businessWhy Teams call analytics are critical to your entire business
Why Teams call analytics are critical to your entire business
 
Connector Corner: Accelerate revenue generation using UiPath API-centric busi...
Connector Corner: Accelerate revenue generation using UiPath API-centric busi...Connector Corner: Accelerate revenue generation using UiPath API-centric busi...
Connector Corner: Accelerate revenue generation using UiPath API-centric busi...
 
Biography Of Angeliki Cooney | Senior Vice President Life Sciences | Albany, ...
Biography Of Angeliki Cooney | Senior Vice President Life Sciences | Albany, ...Biography Of Angeliki Cooney | Senior Vice President Life Sciences | Albany, ...
Biography Of Angeliki Cooney | Senior Vice President Life Sciences | Albany, ...
 
AWS Community Day CPH - Three problems of Terraform
AWS Community Day CPH - Three problems of TerraformAWS Community Day CPH - Three problems of Terraform
AWS Community Day CPH - Three problems of Terraform
 
Strategize a Smooth Tenant-to-tenant Migration and Copilot Takeoff
Strategize a Smooth Tenant-to-tenant Migration and Copilot TakeoffStrategize a Smooth Tenant-to-tenant Migration and Copilot Takeoff
Strategize a Smooth Tenant-to-tenant Migration and Copilot Takeoff
 
Understanding the FAA Part 107 License ..
Understanding the FAA Part 107 License ..Understanding the FAA Part 107 License ..
Understanding the FAA Part 107 License ..
 
CNIC Information System with Pakdata Cf In Pakistan
CNIC Information System with Pakdata Cf In PakistanCNIC Information System with Pakdata Cf In Pakistan
CNIC Information System with Pakdata Cf In Pakistan
 
Introduction to Multilingual Retrieval Augmented Generation (RAG)
Introduction to Multilingual Retrieval Augmented Generation (RAG)Introduction to Multilingual Retrieval Augmented Generation (RAG)
Introduction to Multilingual Retrieval Augmented Generation (RAG)
 
EMPOWERMENT TECHNOLOGY GRADE 11 QUARTER 2 REVIEWER
EMPOWERMENT TECHNOLOGY GRADE 11 QUARTER 2 REVIEWEREMPOWERMENT TECHNOLOGY GRADE 11 QUARTER 2 REVIEWER
EMPOWERMENT TECHNOLOGY GRADE 11 QUARTER 2 REVIEWER
 
TrustArc Webinar - Unlock the Power of AI-Driven Data Discovery
TrustArc Webinar - Unlock the Power of AI-Driven Data DiscoveryTrustArc Webinar - Unlock the Power of AI-Driven Data Discovery
TrustArc Webinar - Unlock the Power of AI-Driven Data Discovery
 
Artificial Intelligence Chap.5 : Uncertainty
Artificial Intelligence Chap.5 : UncertaintyArtificial Intelligence Chap.5 : Uncertainty
Artificial Intelligence Chap.5 : Uncertainty
 
DBX First Quarter 2024 Investor Presentation
DBX First Quarter 2024 Investor PresentationDBX First Quarter 2024 Investor Presentation
DBX First Quarter 2024 Investor Presentation
 
WSO2's API Vision: Unifying Control, Empowering Developers
WSO2's API Vision: Unifying Control, Empowering DevelopersWSO2's API Vision: Unifying Control, Empowering Developers
WSO2's API Vision: Unifying Control, Empowering Developers
 
Boost Fertility New Invention Ups Success Rates.pdf
Boost Fertility New Invention Ups Success Rates.pdfBoost Fertility New Invention Ups Success Rates.pdf
Boost Fertility New Invention Ups Success Rates.pdf
 
Six Myths about Ontologies: The Basics of Formal Ontology
Six Myths about Ontologies: The Basics of Formal OntologySix Myths about Ontologies: The Basics of Formal Ontology
Six Myths about Ontologies: The Basics of Formal Ontology
 
+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...
+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...
+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...
 

Fasta file extensions & meaning

  • 1.
  • 2. Bioinformatics represents a new, growing area of science that uses computational approaches to answer biological questions. •Use computer technologies and statistical methods •Manage and analyze a huge volume of biological data
  • 5. Biological ProblemBiological Problem Statistical/ Mathematical Solution Computer Program Bioinformatics Software/ Tools Biological data Result 3 Test Candidate Result in Wet Lab Final Solution with Laboratory Proof Final Solution with Laboratory Proof + Result 2 Result 1 Approximate Result
  • 6.
  • 7. Analyze huge volume of data Don’t need expensive wet lab Same research can be repeated many times No adverse effect Time saving
  • 8.
  • 10. An example of a multiple sequence FASTA file >SEQUENCE_1 MTEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAK KADRLAAEGVSVKVSDDFTIAAMRPSYLSYEDLDMTFVENEYKALVAELEKE NEERRRLKDPNKPEHKQFASRKQLSDAILKEAEEKIKEELKAQGKPEKIWDNII PGKMNSFIADNSQLDSKLTLMGQFYVMDDKKTVEQVIAEKEKEFGGKIKIVEF ICFEVGEGLEKKTEDFAAEVAAQL >SEQUENCE_2 SATVSEINSETDFVAKNDQFIALTKDTTAHIQSNSLQSVEELHSSTINGVKFEE YLKSQIATIGENLVVRRFATLKAGANGVVNGYIHTNGRVGVVIAAACDSAEVA SKSRDLLRQICMH Fasta sequence always start with this sign Fasta sequence will always have a sequence header
  • 11. GenBank gi|gi-number|gb|accession|locus EMBL Data Library gi|gi-number|emb|accession|locus DDBJ, DNA Database of Japan gi|gi-number|dbj|accession|locus Sequence Header Example from Various Sequence Database NBRF PIR pir||entry P Protein Research Foundation prf||name SWISS-PROT sp|accession|name Brookhaven
  • 12. Protein Data Bank (1) pdb|entry|chain Brookhaven Protein Data Bank (2) entry:chain|PDBID|CHAIN|SEQUENCE Patents pat|country|number GenInfo Backbone Id bbs|number General database identifier gnl|database|identifier NCBI Reference Sequence ref|accession|locus Local Sequence identifier lcl|identifier Some More Example
  • 14. Extension Meaning Notes fasta (.fas) generic fasta Any generic fasta file. Other extensions can be fa, seq, fsa fna fasta nucleic acid Used to generically specify nucleic acids. ffn FASTA nucleotide coding regions Contains coding regions for a genome. faa fasta amino acid Contains amino acids. A multiple protein fasta file can have the more specific extension mpfa. frn FASTA non-coding RNA Contains non-coding RNA regions for a genome, in DNA alphabet e.g. tRNA, rRNA File extension There is no standard file extension for a text file containing FASTA formatted sequences. The table below shows each extension and its respective meaning.
  • 15. Take a look to NCBI Nucleotide database
  • 16. Uniprot Protein Database Showing Link to Download Sequence in Fasta Format