I Jornadas de bioinformática de Granada - Alberto Labarga

2. las multiples caras de la bioinformática [email_address]

3. La bioinformática consiste en la creación y desarrollo de algoritmos, bases de datos , técnicas informáticas y estadísticas , y las bases teóricas para resolver problemas formales y prácticos en torno a la gestión y análisis de información biológica .

4. La vida puede verse como un proceso de almacenamiento y transmisión de información biológica. El ADN es la molécula portadora de esta información. Para entender la vida debemos identificar estas moléculas y descifrar el código

6. “ We wish to propose a structure for the salt of desoxyribose nucleic acid (DNA). This structure has novel features which are of considerable biological interest” “ It has not escaped our attention that the specific pairing we have postulated immediately suggests a possible copying mechanism for the genetic material.”

7. Sanger determinó la secuencia de los aminoácidos de la insulina en 1955. Al hacerlo, demostró que las proteínas tienen estructuras específicas. Este resultado le valió su primer Premio Nobel de química en 1958

8. Cuando Perutz llegó a Cambridge la estructura molecular más grande que se había resuelto era la del pigmento natural ficocianina, de 58 átomos. El tema escogido por Perutz para su tesis fue otra proteína, la hemoglobina, el transportador de oxígeno que da color rojo a nuestra sangre. Tenía 11000 átomos.

9. El primer Atlas of Protein Sequence and Structure, presentaba información sobre 65 proteinas.

10. En 1971 se crea el Protein Data Bank. En 1974 tiene 12 estructuras myoglobin hemoglobin papain ribonuclease lactate dehydrogenase carboxypeptidase A

11. Frederick Sanger publica en 1975 un método para la "Secuenciación del ADN mediante síntesis enzimática".

12. El primer genoma de ADN completamente secuenciado fue el del bacteriófago φX174, en 1977

13. 5,386 bases

14. 11 genes

15. In 1981 the EMBL Nucleotide Sequence Data Library is created. Version 2 was composed of 811 secuences, around 1 million bases introduced by hand.

16. Smith TF, Waterman MS (1981). "Identification of common molecular subsequences.". J Mol Biol. 147 (1): 195-7 .

17. S.F. Altschul, et al. (1990) , "Basic Local Alignment Search Tool," J. Molec. Biol. , 215(3): 403-10, 1990. 15,306 citations

18. J. Thompson, T. Gibson, D. Higgins (1994), CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment. Nuc. Acids. Res. 22, 4673 - 4680

19. En 1995 se crea el European Bioinformatics institute

22. http://www.ensembl.org

23. http://www.uniprot.org

24. herramientas web http://www.ebi.ac.uk/Tools/

25. servicios web SOAP: Simple Object Access Protocol fetchData(uniprot,wap_rat,default,xml) http://www.ebi.ac.uk/Tools/websevices

26. http://taverna.sourceforge.net/

27. http://www.myexperiment.org/users/471

29. http://www.ebi.ac.uk/dasty/

30. 15 de Febrero de 2001: se publica el borrador de la secuencia del genoma humano

32. 3,000,830,137 bases

33. <2%

37. 25,000 genes

38. Bioinformatics: Gone in 2012 http://conferences.oreillynet.com/cs/bio2003/view/e_sess/3452

39. 98% ADN basura

40. ¿basura?

41. ENCyclopedia Of DNA Elements

42. Fire A, Xu S, Montgomery M, Kostas S, Driver S, Mello C (1998). &quot;Potent and specific genetic interference by double-stranded RNA in Caenorhabditis elegans &quot;. Nature 391 (6669): 806–11. doi : 10.1038/35888 . PMID 9486653

43. Hamilton A, Baulcombe D (1999). &quot; A species of small antisense RNA in posttranscriptional gene silencing in plants &quot;. Science 286 (5441): 950–2. PMID 10542148

46. 99,99% idénticos

47. VARIACIÓN EN LA SECUENCIA HUMANA DE DNA Tasa de mutación = 10 -8 /sitio/generación Nº generaciones ancestro común-humano actual: 10 4 -10 5

48. 10.000.000 SNPs

50. $10-million award for the first privately funded team that can sequence 100 human genomes in 10 days for less than 10.000$

51. Applied Biosystems ABI 3730XL Illumina / Solexa Genetic Analyzer Applied Biosystems SOLiD Roche / 454 Genome Sequencer 1 Mb/day 100 Mb/run 3000 Mb/run

52. Sequencing  Fragment assembly problem  The Shortest Superstring Problem  Velvet (Zerbino, 2008) Gene finding  Hidden Markov Models, pattern recognition methods  GenScan (Burge & Karlin, 1997) Sequence comparison  pairwise and multiple sequence alignments  dynamic algorithm, heuristic methods  PSI- BLAST (Altschul et. al., 1997) ( SSAHA, 2001) ( MUMmerGPU, 2008)

53. 2560 JS21 blade computing nodes, each with 2 dual-core, 2.3 GHz, IBM 64-bit PowerPC 970MP processors 10240 CPUs | 20 TB of RAM | 280 TB of external disk

56. Comparative genomics Sequence (DNA/RNA) & phylogeny Regulation of gene expression; transcription factors & micro RNAs Protein sequence analysis & evolution Protein families, motifs and domains Protein structure & function: computational crystallography Protein interactions & complexes: modelling and prediction Chemical biology Pathway analysis Systems modelling Image analysis Data integration & literature mining

57. AKJLSKDUCMMSLSIIEMMCSKLSKCSDCMSKLCCSDKCLSMCLKMCCLSKDCLSMCLSKCSCLSCLSMCLKSCDMCLMKMLWLKWLCMSKMCLSMCLSMCLSKCDJFIOIWELKMLXLWLWKMLWKCLWMCLWMCLWLWCLWKJCLWKCLKDWJCLWKDJCLK

60. http://www.ebi.ac.uk/intact

61. http://www.ebi.ac.uk/biomodels/

62. http://www.cytoscape.org

63. Bioinformatics: alive and kicking. biologists are all bioinformaticians now. http://genomebiology.com/2008/9/12/114

65. una empresa de tecnología... Análisis de datos, señales, imágenes Modelado de sistemas, simulación Bases de datos, data mining, IA Tecnología, comunicación, computación

66. con soluciones para el sector biomédico gestión de datos análisis estadístico anotación análisis de redes selección 30.000 genes 1500 genes 150 genes 50 elementos 10 targets

67. queremos ser pieza fundamental integrando procesos de I+D+i y tecnología en un mecanismo único que permita gestionar todo el proceso y donde la tecnología sea el eslabón más fuerte de la cadena

68. datos gestión análisis visualización

69. data management

70. https://carmaweb.genome.tugraz.at/ http://base.thep.lu.se/

71. http://www.agml.org/

72. http://www.openmicroscopy.org

74. data analysis

75. Biological question Testing Biological verification and interpretation experiment Estimation Experimental design Image analysis Normalization Clustering Prediction Expression quantification Pre-processing Analysis

77. Trans-Proteomic Pipeline (TPP) is a collection of integrated tools for MS/MS proteomics http://tools.proteomecenter.org http://proteowizard.sourceforge.net http://www.thegpm.org/TANDEM

78. BIG data

85. gestión análisis visualización literatura

86. enriquecimiento semántico extracción de información 

87. Antileukoproteinase, Secretory leukocyte protease inhibitor, P03973 uniprot: http://www.uniprot.org/uniprot/ P03973 genecards: http://www.genecards.org/cgi-bin/carddisp.pl?id= P03973 dasty: http://www.ebi.ac.uk/dasty/client/ebi.php?q=P03973 >sp|P03973|SLPI_HUMAN Antileukoproteinase OS=Homo sapiens GN=SLPI MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGK KRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMG MCGKSCVSPVKA