Diese Präsentation wurde erfolgreich gemeldet.
Wir verwenden Ihre LinkedIn Profilangaben und Informationen zu Ihren Aktivitäten, um Anzeigen zu personalisieren und Ihnen relevantere Inhalte anzuzeigen. Sie können Ihre Anzeigeneinstellungen jederzeit ändern.
KONSEP AWAL<br />1970-an  isuinternasional<br />Food security, konsepdifokuskanpadaketersediaanpanganditingkatnasionalmau...
FOOD AVAILABILITY APPROACH<br />Asumsi yang mendasari:<br />JIKA PASOKAN PANGAN TERSEDIA MAKA:<br />Pedagangakanmenyalurka...
PERGESERAN KONSEP<br />1990-an  pergeserankonsep<br />Penekanankonseppadaaksespanganditingkatrumahtanggadanindividu.<br /...
ASPEK KETAHANAN PANGAN<br />Ketersediaanpangansecaracukup, baikdalamjumlahdanmutunya<br />Gizidankesehatan,<br />Ekonomi (...
PEMANFAATAN PANGAN (Food utilization)</li></li></ul><li>SISTEM KETAHANAN PANGAN<br />
SUBSISTEM KETERSEDIAAN PANGAN<br />CAKUPAN ASPEK:<br />Produksi<br />Cadangan,<br />Keseimbanganimpordaneksporpangan.<br /...
SUBSISTEM DISTRIBUSI PANGAN<br />CAKUPAN ASPEK:<br />Aksesibilitasterhadappangan yang meratasecara:<br />Fisik<br />Ekonom...
SUBSISTEM KONSUMSI PANGAN<br />CAKUPAN ASPEK:<br />Peningkatanpengetahuandankemampuanmasyarakatataspangan, gizidankesehata...
INDIKATOR PENILAIAN SITUASI KETAHANAN PANGAN<br />IndikatorAksesPangan:<br /><ul><li>Strategirumahtangga
Copingability indicator</li></ul>IndikatorProses:<br /><ul><li>Produksipertanian
Nächste SlideShare
Wird geladen in …5

Komponen, Indikator Dan Kebijakan Ketahanan Pangan

24.377 Aufrufe

Veröffentlicht am

biar jangan lupa sama ilmu yang pernah didapat, walaupun mungkin tidak atau belum bisa diaplikasikan dalam pekerjaan karena satu dan lain hal ;)
yang penting ilmu itu dibagikan, mudah2an bisa bermanfaat.

demikian juga presentasi ini, saya buat dari diktat salah satu materi yang diikuti dalam Pelatihan dan Apresiasi Ketahanan Pangan, di Bandung Agustus 2007
Waktu itu disampaikan dengan sangat menarik dan berkesan oleh: Dr.Ir.Yayuk Farida Baliwati, MS (GMSK – IPB)
Diselenggarakan oleh Dinas Pertanian Prov. Jawa Barat

Veröffentlicht in: News & Politik
  • Loggen Sie sich ein, um Kommentare anzuzeigen.

Komponen, Indikator Dan Kebijakan Ketahanan Pangan

  3. 3. KONSEP AWAL<br />1970-an  isuinternasional<br />Food security, konsepdifokuskanpadaketersediaanpanganditingkatnasionalmaupuninternasional<br />Pemicu : Krisispangandunia 1972 – 1974<br />Kebijakanketahananpangandi Indonesia didasarkanpada: “pendekatanpenyediaanpangan” yang dikenalsebagai FAA (Food Availability Approach)<br />
  4. 4. FOOD AVAILABILITY APPROACH<br />Asumsi yang mendasari:<br />JIKA PASOKAN PANGAN TERSEDIA MAKA:<br />Pedagangakanmenyalurkanpangankeseluruhwilayahsecaraefisien<br />Hargapanganakantetapstabilpadatingkatwajarsehinggaterjangkauolehseluruhkeluarga<br />Fenomena HUNGER PARADOX  Meskipun PANGAN CUKUP, sebagianorangmasih MENDERITA KELAPARAN karenatidakmempunyai AKSES YANG CUKUP terhadappangan.<br />FAA tidakmemperhatikanaspekdistribusidanaksesterhadappangan<br />
  5. 5. PERGESERAN KONSEP<br />1990-an  pergeserankonsep<br />Penekanankonseppadaaksespanganditingkatrumahtanggadanindividu.<br />Definisi : “Access for all people at all times to enough food for an active and healthy life”  diterimaluasolehpraktisidanakademisi.<br />Dasardalamkonteksrumahtangga : KONSEPENTITLEMENTatauKemampuanuntukmenguasaipangan.<br />Indonesia mengadopsikonsepdalam UU No. 7 Tahun 1996 tentangPangan. <br />Definisi : Kondisiterpenuhinyapanganbagirumahtangga yang tercermindaritersedianyapangan yang cukup, baikjumlahmaupunmutunya, aman, meratadanterjangkau.<br />
  8. 8. ASPEK KETAHANAN PANGAN<br />Ketersediaanpangansecaracukup, baikdalamjumlahdanmutunya<br />Gizidankesehatan,<br />Ekonomi (dayabeli),<br />Keadilandankesinambungan (merataantarrumahtangga, kelompokmasyarakatataudaerahsesuaikebutuhandanmeratasepanjangwaktu).<br />
  9. 9. KOMPONEN UTAMA KETAHANAN PANGAN<br /><ul><li>KETERSEDIAAN DAN STABILITAS PANGAN (Food availability and stability)
  10. 10. KEMUDAHAN MEMPEROLEH PANGAN (Food accessibility)
  11. 11. PEMANFAATAN PANGAN (Food utilization)</li></li></ul><li>SISTEM KETAHANAN PANGAN<br />
  12. 12. SUBSISTEM KETERSEDIAAN PANGAN<br />CAKUPAN ASPEK:<br />Produksi<br />Cadangan,<br />Keseimbanganimpordaneksporpangan.<br />FUNGSI: <br />Menjaminpasokanpanganuntukmemenuhikebutuhanpenduduk, baikdarisisijumlah, kualitas, keragamandankeamanan.<br />ACUAN PENILAIAN KETERSEDIAAN: <br />AKE (AngkaKecukupanEnergi ) = 2200 kal/kapita/hari<br />AKP (AngkaKecukupan Protein) = 57 gram/kapita/hari<br />ACUAN PENILAIAN KERAGAMAN KETERSEDIAAN:<br />Skor PPH (PolaPanganHarapan) = 100<br />
  13. 13. SUBSISTEM DISTRIBUSI PANGAN<br />CAKUPAN ASPEK:<br />Aksesibilitasterhadappangan yang meratasecara:<br />Fisik<br />Ekonomi (HargadanDayaBeli)<br />FUNGSI:<br />Mewujudkansistemdistribusi yang efektifdanefisiensebagaiprasyaratuntukmenjamin agar seluruhrumahtanggadapatmemperolehpangandalamjumlahdankualitas yang baiksepanjangwaktu.<br />INDIKATOR KINERJA SUBSISTEM: <br />STABILITAS PASOKAN<br />STABILITAS HARGA<br />
  15. 15. SUBSISTEM KONSUMSI PANGAN<br />CAKUPAN ASPEK:<br />Peningkatanpengetahuandankemampuanmasyarakatataspangan, gizidankesehatan yang baik<br />Masyarakatdapatmengatur menu beragam, bergizi, seimbang optimal, sanitasidanhigienitasdanpencegahanpenyakitinfeksidalamlingkunganrumahtangga<br />FUNGSI:<br />Mengarahkan agar polapemanfaatanpanganmemenuhikaidah:<br />Mutu<br />Keragamandankeseimbangangizi<br />Keamanandanhalal<br />Efisiensimencegahpemborosan<br />INDIKATOR KINERJA SUBSISTEM:<br />Polakonsumsimasyarakatdanrumahtangga<br />
  16. 16. INDIKATOR PENILAIAN SITUASI KETAHANAN PANGAN<br />IndikatorAksesPangan:<br /><ul><li>Strategirumahtangga
  17. 17. Copingability indicator</li></ul>IndikatorProses:<br /><ul><li>Produksipertanian
  18. 18. Iklim
  19. 19. Aksesthdsdalam
  20. 20. Praktekpengelolaanlahan
  21. 21. Pengembanganinstitusi
  22. 22. Pasar
  23. 23. Konflik regional
  24. 24. Kerusuhansosial</li></ul>IndikatorDampak:<br /><ul><li>Dampaklangsung
  25. 25. Dampaktidaklangsung</li></li></ul><li>KEBIJAKAN<br />KETAHANAN PANGAN<br />
  26. 26. Peraturanperundang-undangantentang KETAHANAN PANGAN<br />IMPLISIT<br />UUD RI 1945 Pasal 28 ayat 1 amandemenkedua:<br /> “Setiaporangberhakuntukhidup, sejahteralahirdanbatin, bertempattinggaldanmendapatkanlingkunganhidup yang baikdansehatsertaberhakmemperolehlayanankesehatan”<br />UU No. 39 Tahun 1999 tentangHakAsasiManusia; Pasal 9 ayat 1:<br />“Setiaporangberhakuntukhidup, mempertahankanhidupdanmeningkatkantarafkehidupannya.<br />
  27. 27. EKSPLISIT<br />UU No.7 Tahun 1996 tentangPangan<br />Menjelaskankonsep, komponensertaparapihak (yaitupmerintahbersamamasyarakat) yang harusberperandalammewujudkanketahananpangan.<br />UU No 32 tahun 2004 tentangPemerintahan Daerah, Pasal 11 ayat (3)<br />Ketahanapanganmerupakansalahsatuurusan yang wajibdiselenggarakanolehpemerintahandaerahprovinsidanpemerintahandaerahkabupaten / kota, berkaitandenganpelayanandasar<br />UU No. 41 Tahun 2009 tentangPerlindunganLahanPertanianPanganBerkelanjutan<br />PP No. 69 Tahun 1999 tentang Label danIklanPangan<br />Mengaturpembinaandanpengawasandibidang label daniklanpangandalamrangkamenciptakanperdaganganpangan yang jujurdanbertanggungjawab.<br />PP No. 68 Tahun 2002 tentangKetahananPangan<br />Mengaturketahananpanganmencakupaspekketersediaan, adangan, penganekaragaman, pencegahandanpenanggulanganmasalahpangan, peranpemerintahpusatdandaerahsertamasyarakatdanpengembangansumberdayamanusia.<br />
  28. 28. PP No. 28 Tahun 2004 tantangKeamanan, MutudanGiziPangan,<br />Mengaturpemasukandanpngeluaranpangankewilayah Indonesia, pengawasandanpembinaansertaperansertamasyarakat<br />Keppres No.132 Tahun 2001 dandisempurnakanmenjadiPerpres No. 83 Tahun 2006<br />PembentukanDewanKetahananPangan (DKP). <br />Pasal 2, DKP mempunyaitugasmebantuPresidendalam:<br />Merumuskankebijakandalamrangkamewujudkanketahananpangannasional<br />Melaksananakanvaluasidanpengendaliandalamrangkamewujudkanketahananpangannasional<br />Pasal 7 dan 10:<br />Mengarahkanpembentukan DKP PropinsidanKebupaten/Kota untukmengkoordinasikanseluruhkebijakandan program yang terkaitdenganupayamewujudkanketahananpanganditingkatPropinsi/Kabupaten/Kota danNasional<br />PP No. 5 tahun 2010 tentangRencana Pembangunan JangkaMenengahNasionalTahun 2010-2014<br />PP No. 41 Tahun 2007 tentangOrganisasiPerangkat Daerah;<br />PembentukanBadanKetahananPanganatau unit kerjastruktural yang menanganiketahananpangan. Unit kerjatersebutdisarankanberbentukkantorataubadan.<br />
  29. 29. TUJUAN PEMBANGUNAN KETAHANAN PANGAN <br />Mempertahankanketersediaanenergiperkapita minimal 2200 kkal/hr dan protein 57 g/hr<br />Meningkatkankonsumsipanganperkapitauntukmemenuhikecukupanenergi minimal 2000 kkal/hr dan protein minimal 52 gr/hr<br />Meningkatkankualitaskonsumsipanganmasyarakatdenganskor PPH minimal 80 (padi-padian 275 g, umbi 100 g, panganhewani 150 g, kacang2an 35 g, sayurdanbuah 250 g)<br />Meningkatkankeamanan, mutudanhigienepangan yang dikonsumsi<br />Mengurangijumlah/persentasependudukrawanpangankronis (<80%AKG) danpendudukmiskin minimal 1% pertahun, termasukibuhamil yang anemia danbalitakuranggizi<br />Meningkatkankemandirianpanganmelaluiswasembadaberassecaraberkelanjutan, swasembadajagungtahun 2007, kedele 2015, gulatahun 2009, dagingsapi 2010, sertameminimalkanimporpanganutamalebihrendahdari 10% kebutuhanpenduduk.<br />Meningkatkanrasiolahanperorang (land-man ratio) melaluipenetapanlahanabadiberirigasi minimal 15 juta ha, danlahankering minimal 15 juta ha<br />Meningkatkankemampuanpengelolaancadanganpanganpemerintah<br />Meningkatkanjangkauanjaringandistribusidanpemasaranpangankeseluruhdaerah<br />Meningkatkankemampuannasionaldalammengenali, mengantisipasidanmenanganisecaradinisertamelakukantanggapdaruratmasalahrawanpangandangizi<br />
  30. 30. ELEMEN PENTING KEBIJAKAN UMUM KETAHANAN PANGAN<br />Menjaminketersediaanpangan<br />Menatapertanahan, tataruangdanwilayah<br />Mengembangkancadanganpangan<br />Mengembangkansistemdistribusipangan yang adildanefisien<br />Menjagastabilitashargapangan<br />Meningkatkanaksesibilitasrumahtanggaterhadappangan<br />Melakukandiversifikasipangan<br />Meningkatkanmutudankeamananpangan<br />Mencegahdanmenanganikeadaanrawanpangandangizi<br />Memfasilitasipenelitiandanpengembangan<br />Meningkatkanperansertamasyarakat<br />Melaksanakankerjasamainternasional<br />Mengembangkansumberdayamanusia<br />Kebijakanmakrodanperdagangan yang kondusif<br />
  31. 31. Tolooong..… akuingintumbuhsehatdanpintar<br />
