SlideShare ist ein Scribd-Unternehmen logo
1 von 28
This presentation is
brought to you by
Grammar Bytes!,
©2023 by Robin L.
Simmons.
Spelling
I before E? Or is it E
before I?
This presentation
covers commonly
misspelled
words and
knowledge of
spelling rules—
all of which,
unfortunately, have
exceptions!
Spelling items on an
objective test might look
like these ...
Sample Item 1
Because we were hungary, we could not
concentrate on the lecture. We will definitely
consult Wanda since she was fueling her brain
with a fruit smoothie.
A. hungry
B. definately
C. feuling
D. No change is necessary.
Because we were hungary, we could not
A
concentrate on the lecture. We will definitely
B
consult Wanda since she was fueling her brain
C
with a fruit smoothie.
A. hungry
B. definately
C. feuling
D. No change is necessary.
Because we were hungry, we could not
A
concentrate on the lecture. We will definitely
B
consult Wanda since she was fueling her brain
C
with a fruit smoothie.
A. hungry
B. definately
C. feuling
D. No change is necessary.
Is hungary,
definitely, or
fueling
misspelled?
Hungry is
definitely
misspelled, but
choice A
corrects it!
Sample Item 2
At the flea market, Harold bought fresh tomatoes,
a pair of used jeans, and a stuffed deer head with
a broken antler. He considered the shopping trip
successfull.
A. succesful
B. successful
C. sucessful
D. No change is necessary.
At the flea market, Harold bought fresh tomatoes,
a pair of used jeans, and a stuffed deer head with
a broken antler. He considered the shopping trip
successfull.
A. succesful
B. successful
C. sucessful
D. No change is necessary.
Is successfull
misspelled? If so,
which choice
corrects it?
Choice B does
the job—two cs,
two ss, but only
one l.
At many objective exams,
you cannot use a dictionar y!
X
When in doubt, rely on
“gut” feelings.
Your eyes have seen in print—and your
brain has registered—all of the possible
words that you will encounter for this skill. If
you don’t recognize the right answer, go
with the one that feels right.
Hey, I know
that word!
Plurals, Part 1
To finish his algebra problem, Chad needed to
find his glass.
• Most words become plural by adding s:
chickenchickens, bookbooks, kitekites
• Use es for words ending in s, sh, x, z, or “soft”
ch: beachbeaches, fixfixes, quizquizzes
To finish his algebra problems, Chad needed to
find his glasses.
Do you like my
funky lenses?
Plurals, Part 2
Our ears were glued to the radio as we listened to
news about the tornado.
• Words ending in a vowel + o become plural by
adding s: rodeorodeos, duoduos
• Words ending in a consonant + o become plural
by adding es: tomatotomatoes, heroheroes
Take
cover!
Our ears were glued to the radios as we listened to
news about the tornadoes.
Plurals, Part 3
Our life would improve if the giraffs quit eating the
leafs off our shrubs.
• Many words that end in f or fe become plural
with ves: leafleaves, lifelives,
knifeknives
• Words that end in ff or ffe become plural with
just an s: knockoffknockoffs, giraffegiraffes
Our lives would improve if the giraffes quit
eating the leaves off our shrubs.
Stop
that!
Final Y Words
Chad tryed to save his money, but the flea market
had too many good buy.
• If you have consonant + final y, change the y
to i when you add any suffix except one beginning
with i: easyeasily, fiftyfiftieth, skyskies
• If you have vowel + final y, keep the y when you
add a suffix: monkeymonkeys, toytoys
Chad tried to save his money, but the flea market
had too many good buys.
I’m a sucker
for “Buy 3, Get
1 Free”!
Final E Words
Climbing to the top of the mountain was too
challengeing, so we gave up and wallowed in
discouragment.
• If a suffix begins with a vowel, you will usually
remove the final e: hopehoping,
loveloving, participateparticipating
• If a suffix begins with a consonant, you will
usually keep the final e: lovelovely,
amuseamusement, hopehopeful
Climbing to the top of the mountain was too
challenging, so we gave up and wallowed in
discouragement.
We were so
close!
Doubling Final Consonants
• If you have a one-syllable word that ends in
vowel + consonant, double the consonant
when you add a suffix that begins with a
vowel or is a y: sadsaddened,
swimswimming, skinskinny
• If you have a multi-syllable word that ends in
vowel + consonant—with the accent falling
on the last syllable of the root word—double
the consonant: admitadmitted,
beginbeginner, forbidforbidding
Read this sample:
Chad steped in a puddle and sliped off
the sidewalk. He regreted his clumsiness
when he spoted the mud stain on his pants.
Chad stepped in a puddle and slipped off
the sidewalk. He regretted his clumsiness
when he spotted the mud stain on his pants.
Whoa!
IE/EI Words
Chad is concieted about the bulging viens in
his rippling muscles. He beleives that all of
the females are admiring his great physique.
• Often, i comes before e: belief, chief, review
• If the i and e follow c, they usually reverse:
ceiling, conceive, receive
• E also precedes i if the sound is a long a:
eight, neighbor, weigh
Chad is conceited about the bulging veins in
his rippling muscles. He believes that all of
the females are admiring his great physique.
Let me flex my
biceps!
Quick Test
Directions: In the items that follow, choose
the option that corrects an error in the
underlined portion(s). If no error exists, choose
“No change is necessary.”
Show me
what you
know!
Item 1
Carlos hopped that he caught all of the
misspellings in his essay, for he wanted to
receive an A on this paper.
A. hoped
B. mispellings
C. recieve
D. No change is necessary.
Carlos hopped that he caught all of the
A
misspellings in his essay, for he wanted to
B
receive an A on this paper.
C
A. hoped
B. mispellings
C. recieve
D. No change is necessary.
Carlos hoped that he caught all of the
A
misspellings in his essay, for he wanted to
B
receive an A on this paper.
C
A. hoped
B. mispellings
C. recieve
D. No change is necessary.
Item 2
The thieves planned to steal Mom’s expensive
jewellry but changed their minds when they
discovered Big Boy, our Rottweiler, guarding the
master bedroom.
A. theives
B. jewelry
C. guardding
D. No change is necessary.
The thieves planned to steal Mom’s expensive
A
jewellry but changed their minds when they
B
discovered Big Boy, our Rottweiler, guarding the
C
master bedroom.
A. theives
B. jewelry
C. guardding
D. No change is necessary.
The thieves planned to steal Mom’s expensive
A
jewelry but changed their minds when they
B
discovered Big Boy, our Rottweiler, guarding the
C
master bedroom.
A. theives
B. jewelry
C. guardding
D. No change is necessary.
Item 3
When we told Sheila that her boyfriend Ronnie
accompanied Kristine to a fancy restaurant last
night, Sheila told us to mind our own bussiness.
A. accompanyed
B. resterant
C. business
D. No change is necessary.
When we told Sheila that her boyfriend Ronnie
accompanied Kristine to a fancy restaurant last
A B
night, Sheila told us to mind our own bussiness.
C
A. accompanyed
B. resterant
C. business
D. No change is necessary.
When we told Sheila that her boyfriend Ronnie
accompanied Kristine to a fancy restaurant last
A B
night, Sheila told us to mind our own business.
C
A. accompanyed
B. resterant
C. business
D. No change is necessary.
Item 4
I don’t mind sharing a dessert with Matthew, but I
must insist on a sepparate fork.
A. separate
B. seperate
C. saperate
D. No change is necessary.
I don’t mind sharing a dessert with Matthew, but I
must insist on a sepparate fork.
A. separate
B. seperate
C. saperate
D. No change is necessary.
I don’t mind sharing a dessert with Matthew, but I
must insist on a sepparate fork.
A. separate
B. seperate
C. saperate
D. No change is necessary.
Item 5
Professor Williams recommends studing two
hours every night; we students wish we had the
time but must work to pay for the expensive
textbooks that he requires.
A. reccomends
B. studying
C. espensive
D. No change is necessary.
Professor Williams recommends studing two
A B
hours every night; we students wish we had the
time but must work to pay for the expensive
C
textbooks that he requires.
A. reccomends
B. studying
C. espensive
D. No change is necessary.
Professor Williams recommends studying two
A B
hours every night; we students wish we had the
time but must work to pay for the expensive
C
textbooks that he requires.
A. reccomends
B. studying
C. espensive
D. No change is necessary.
Item 6
All day long, our new puppy Jack sleeps on the
rug, but at night, he is possesed by energy and
bounces off the furniture.
A. posessed
B. possested
C. possessed
D. No change is necessary.
All day long, our new puppy Jack sleeps on the
rug, but at night, he is possesed by energy and
bounces off the furniture.
A. posessed
B. possested
C. possessed
D. No change is necessary.
All day long, our new puppy Jack sleeps on the
rug, but at night, he is possesed by energy and
bounces off the furniture.
A. posessed
B. possested
C. possessed
D. No change is necessary.
Item 7
Ramón wishs that the lovely Belinda would blow
kisses his way, but he is always disappointed.
A. wishes
B. kissess
C. dissappointed
D. No change is necessary.
Ramón wishs that the lovely Belinda would blow
A
kisses his way, but he is always disappointed.
B C
A. wishes
B. kissess
C. dissappointed
D. No change is necessary.
Ramón wishes that the lovely Belinda would blow
A
kisses his way, but he is always disappointed.
B C
A. wishes
B. kissess
C. dissappointed
D. No change is necessary.
Item 8
To please his wife, Robert swept off the roof, even
though he found this chore pointless and
unnecessary.
A. unecessary
B. unnecessery
C. unneccessary
D. No change is necessary.
To please his wife, Robert swept off the roof, even
though he found this chore pointless and
unnecessary.
A. unecessary
B. unnecessery
C. unneccessary
D. No change is necessary.
To please his wife, Robert swept off the roof, even
though he found this chore pointless and
unnecessary.
A. unecessary
B. unnecessery
C. unneccessary
D. No change is necessary.
Item 9
Patrick tried to make Babushka’s potatoe
pancakes, but we found them inedible; everyone
wished he had made simple French fries instead.
A. potato
B. ineddible
C. frys
D. No change is necessary.
Patrick tried to make Babushka’s potatoe
A
pancakes, but we found them inedible; everyone
B
wished he had made simple French fries instead.
C
A. potato
B. ineddible
C. frys
D. No change is necessary.
Patrick tried to make Babushka’s potato
A
pancakes, but we found them inedible; everyone
B
wished he had made simple French fries instead.
C
A. potato
B. ineddible
C. frys
D. No change is necessary.
Item 10
Look at Jonathan’s face turning red—that boy
embarasses easily!
A. embarrases
B. emmbarasses
C. embarrasses
D. No change is necessary.
Look at Jonathan’s face turning red—that boy
embarasses easily!
A. embarrases
B. emmbarasses
C. embarrasses
D. No change is necessary.
Look at Jonathan’s face turning red—that boy
embarasses easily!
A. embarrases
B. emmbarasses
C. embarrasses
D. No change is necessary.
The End.

Weitere ähnliche Inhalte

Ähnlich wie spelling.ppt (20)

fhcgvjblkhj.iouilkdcghvhhlksvagreement.ppt
fhcgvjblkhj.iouilkdcghvhhlksvagreement.pptfhcgvjblkhj.iouilkdcghvhhlksvagreement.ppt
fhcgvjblkhj.iouilkdcghvhhlksvagreement.ppt
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
coordinate_subordinate.ppt
coordinate_subordinate.pptcoordinate_subordinate.ppt
coordinate_subordinate.ppt
 
Verb forms
Verb formsVerb forms
Verb forms
 
confusedwords.ppt
confusedwords.pptconfusedwords.ppt
confusedwords.ppt
 
Tenseshift
TenseshiftTenseshift
Tenseshift
 
Verb Forms
Verb FormsVerb Forms
Verb Forms
 
Svagreement
SvagreementSvagreement
Svagreement
 
Punctuation
PunctuationPunctuation
Punctuation
 
Modifiers
Modifiers Modifiers
Modifiers
 
Capitalization
CapitalizationCapitalization
Capitalization
 
Tense Shift
Tense ShiftTense Shift
Tense Shift
 
Verb forms
Verb formsVerb forms
Verb forms
 
Verb Forms
Verb Forms Verb Forms
Verb Forms
 
pronoun -----agreement for primary s.ppt
pronoun -----agreement for primary s.pptpronoun -----agreement for primary s.ppt
pronoun -----agreement for primary s.ppt
 
Verbforms
VerbformsVerbforms
Verbforms
 

Kürzlich hochgeladen

1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 -  Danh muc Sach Giao Khoa 10 . pdf1029 -  Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdf
QucHHunhnh
 
Seal of Good Local Governance (SGLG) 2024Final.pptx
Seal of Good Local Governance (SGLG) 2024Final.pptxSeal of Good Local Governance (SGLG) 2024Final.pptx
Seal of Good Local Governance (SGLG) 2024Final.pptx
negromaestrong
 
1029-Danh muc Sach Giao Khoa khoi 6.pdf
1029-Danh muc Sach Giao Khoa khoi  6.pdf1029-Danh muc Sach Giao Khoa khoi  6.pdf
1029-Danh muc Sach Giao Khoa khoi 6.pdf
QucHHunhnh
 

Kürzlich hochgeladen (20)

This PowerPoint helps students to consider the concept of infinity.
This PowerPoint helps students to consider the concept of infinity.This PowerPoint helps students to consider the concept of infinity.
This PowerPoint helps students to consider the concept of infinity.
 
Micro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdfMicro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdf
 
Making communications land - Are they received and understood as intended? we...
Making communications land - Are they received and understood as intended? we...Making communications land - Are they received and understood as intended? we...
Making communications land - Are they received and understood as intended? we...
 
Kodo Millet PPT made by Ghanshyam bairwa college of Agriculture kumher bhara...
Kodo Millet  PPT made by Ghanshyam bairwa college of Agriculture kumher bhara...Kodo Millet  PPT made by Ghanshyam bairwa college of Agriculture kumher bhara...
Kodo Millet PPT made by Ghanshyam bairwa college of Agriculture kumher bhara...
 
1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 -  Danh muc Sach Giao Khoa 10 . pdf1029 -  Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdf
 
Seal of Good Local Governance (SGLG) 2024Final.pptx
Seal of Good Local Governance (SGLG) 2024Final.pptxSeal of Good Local Governance (SGLG) 2024Final.pptx
Seal of Good Local Governance (SGLG) 2024Final.pptx
 
Third Battle of Panipat detailed notes.pptx
Third Battle of Panipat detailed notes.pptxThird Battle of Panipat detailed notes.pptx
Third Battle of Panipat detailed notes.pptx
 
Grant Readiness 101 TechSoup and Remy Consulting
Grant Readiness 101 TechSoup and Remy ConsultingGrant Readiness 101 TechSoup and Remy Consulting
Grant Readiness 101 TechSoup and Remy Consulting
 
How to Manage Global Discount in Odoo 17 POS
How to Manage Global Discount in Odoo 17 POSHow to Manage Global Discount in Odoo 17 POS
How to Manage Global Discount in Odoo 17 POS
 
Sociology 101 Demonstration of Learning Exhibit
Sociology 101 Demonstration of Learning ExhibitSociology 101 Demonstration of Learning Exhibit
Sociology 101 Demonstration of Learning Exhibit
 
1029-Danh muc Sach Giao Khoa khoi 6.pdf
1029-Danh muc Sach Giao Khoa khoi  6.pdf1029-Danh muc Sach Giao Khoa khoi  6.pdf
1029-Danh muc Sach Giao Khoa khoi 6.pdf
 
Dyslexia AI Workshop for Slideshare.pptx
Dyslexia AI Workshop for Slideshare.pptxDyslexia AI Workshop for Slideshare.pptx
Dyslexia AI Workshop for Slideshare.pptx
 
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdf
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdfUGC NET Paper 1 Mathematical Reasoning & Aptitude.pdf
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdf
 
How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17
 
ICT role in 21st century education and it's challenges.
ICT role in 21st century education and it's challenges.ICT role in 21st century education and it's challenges.
ICT role in 21st century education and it's challenges.
 
Spatium Project Simulation student brief
Spatium Project Simulation student briefSpatium Project Simulation student brief
Spatium Project Simulation student brief
 
Unit-IV- Pharma. Marketing Channels.pptx
Unit-IV- Pharma. Marketing Channels.pptxUnit-IV- Pharma. Marketing Channels.pptx
Unit-IV- Pharma. Marketing Channels.pptx
 
ComPTIA Overview | Comptia Security+ Book SY0-701
ComPTIA Overview | Comptia Security+ Book SY0-701ComPTIA Overview | Comptia Security+ Book SY0-701
ComPTIA Overview | Comptia Security+ Book SY0-701
 
Key note speaker Neum_Admir Softic_ENG.pdf
Key note speaker Neum_Admir Softic_ENG.pdfKey note speaker Neum_Admir Softic_ENG.pdf
Key note speaker Neum_Admir Softic_ENG.pdf
 
Application orientated numerical on hev.ppt
Application orientated numerical on hev.pptApplication orientated numerical on hev.ppt
Application orientated numerical on hev.ppt
 

spelling.ppt

  • 1. This presentation is brought to you by Grammar Bytes!, ©2023 by Robin L. Simmons.
  • 2. Spelling I before E? Or is it E before I?
  • 3. This presentation covers commonly misspelled words and knowledge of spelling rules— all of which, unfortunately, have exceptions!
  • 4. Spelling items on an objective test might look like these ...
  • 5. Sample Item 1 Because we were hungary, we could not concentrate on the lecture. We will definitely consult Wanda since she was fueling her brain with a fruit smoothie. A. hungry B. definately C. feuling D. No change is necessary. Because we were hungary, we could not A concentrate on the lecture. We will definitely B consult Wanda since she was fueling her brain C with a fruit smoothie. A. hungry B. definately C. feuling D. No change is necessary. Because we were hungry, we could not A concentrate on the lecture. We will definitely B consult Wanda since she was fueling her brain C with a fruit smoothie. A. hungry B. definately C. feuling D. No change is necessary. Is hungary, definitely, or fueling misspelled? Hungry is definitely misspelled, but choice A corrects it!
  • 6. Sample Item 2 At the flea market, Harold bought fresh tomatoes, a pair of used jeans, and a stuffed deer head with a broken antler. He considered the shopping trip successfull. A. succesful B. successful C. sucessful D. No change is necessary. At the flea market, Harold bought fresh tomatoes, a pair of used jeans, and a stuffed deer head with a broken antler. He considered the shopping trip successfull. A. succesful B. successful C. sucessful D. No change is necessary. Is successfull misspelled? If so, which choice corrects it? Choice B does the job—two cs, two ss, but only one l.
  • 7. At many objective exams, you cannot use a dictionar y! X
  • 8. When in doubt, rely on “gut” feelings. Your eyes have seen in print—and your brain has registered—all of the possible words that you will encounter for this skill. If you don’t recognize the right answer, go with the one that feels right. Hey, I know that word!
  • 9. Plurals, Part 1 To finish his algebra problem, Chad needed to find his glass. • Most words become plural by adding s: chickenchickens, bookbooks, kitekites • Use es for words ending in s, sh, x, z, or “soft” ch: beachbeaches, fixfixes, quizquizzes To finish his algebra problems, Chad needed to find his glasses. Do you like my funky lenses?
  • 10. Plurals, Part 2 Our ears were glued to the radio as we listened to news about the tornado. • Words ending in a vowel + o become plural by adding s: rodeorodeos, duoduos • Words ending in a consonant + o become plural by adding es: tomatotomatoes, heroheroes Take cover! Our ears were glued to the radios as we listened to news about the tornadoes.
  • 11. Plurals, Part 3 Our life would improve if the giraffs quit eating the leafs off our shrubs. • Many words that end in f or fe become plural with ves: leafleaves, lifelives, knifeknives • Words that end in ff or ffe become plural with just an s: knockoffknockoffs, giraffegiraffes Our lives would improve if the giraffes quit eating the leaves off our shrubs. Stop that!
  • 12. Final Y Words Chad tryed to save his money, but the flea market had too many good buy. • If you have consonant + final y, change the y to i when you add any suffix except one beginning with i: easyeasily, fiftyfiftieth, skyskies • If you have vowel + final y, keep the y when you add a suffix: monkeymonkeys, toytoys Chad tried to save his money, but the flea market had too many good buys. I’m a sucker for “Buy 3, Get 1 Free”!
  • 13. Final E Words Climbing to the top of the mountain was too challengeing, so we gave up and wallowed in discouragment. • If a suffix begins with a vowel, you will usually remove the final e: hopehoping, loveloving, participateparticipating • If a suffix begins with a consonant, you will usually keep the final e: lovelovely, amuseamusement, hopehopeful Climbing to the top of the mountain was too challenging, so we gave up and wallowed in discouragement. We were so close!
  • 14. Doubling Final Consonants • If you have a one-syllable word that ends in vowel + consonant, double the consonant when you add a suffix that begins with a vowel or is a y: sadsaddened, swimswimming, skinskinny • If you have a multi-syllable word that ends in vowel + consonant—with the accent falling on the last syllable of the root word—double the consonant: admitadmitted, beginbeginner, forbidforbidding
  • 15. Read this sample: Chad steped in a puddle and sliped off the sidewalk. He regreted his clumsiness when he spoted the mud stain on his pants. Chad stepped in a puddle and slipped off the sidewalk. He regretted his clumsiness when he spotted the mud stain on his pants. Whoa!
  • 16. IE/EI Words Chad is concieted about the bulging viens in his rippling muscles. He beleives that all of the females are admiring his great physique. • Often, i comes before e: belief, chief, review • If the i and e follow c, they usually reverse: ceiling, conceive, receive • E also precedes i if the sound is a long a: eight, neighbor, weigh Chad is conceited about the bulging veins in his rippling muscles. He believes that all of the females are admiring his great physique. Let me flex my biceps!
  • 17. Quick Test Directions: In the items that follow, choose the option that corrects an error in the underlined portion(s). If no error exists, choose “No change is necessary.” Show me what you know!
  • 18. Item 1 Carlos hopped that he caught all of the misspellings in his essay, for he wanted to receive an A on this paper. A. hoped B. mispellings C. recieve D. No change is necessary. Carlos hopped that he caught all of the A misspellings in his essay, for he wanted to B receive an A on this paper. C A. hoped B. mispellings C. recieve D. No change is necessary. Carlos hoped that he caught all of the A misspellings in his essay, for he wanted to B receive an A on this paper. C A. hoped B. mispellings C. recieve D. No change is necessary.
  • 19. Item 2 The thieves planned to steal Mom’s expensive jewellry but changed their minds when they discovered Big Boy, our Rottweiler, guarding the master bedroom. A. theives B. jewelry C. guardding D. No change is necessary. The thieves planned to steal Mom’s expensive A jewellry but changed their minds when they B discovered Big Boy, our Rottweiler, guarding the C master bedroom. A. theives B. jewelry C. guardding D. No change is necessary. The thieves planned to steal Mom’s expensive A jewelry but changed their minds when they B discovered Big Boy, our Rottweiler, guarding the C master bedroom. A. theives B. jewelry C. guardding D. No change is necessary.
  • 20. Item 3 When we told Sheila that her boyfriend Ronnie accompanied Kristine to a fancy restaurant last night, Sheila told us to mind our own bussiness. A. accompanyed B. resterant C. business D. No change is necessary. When we told Sheila that her boyfriend Ronnie accompanied Kristine to a fancy restaurant last A B night, Sheila told us to mind our own bussiness. C A. accompanyed B. resterant C. business D. No change is necessary. When we told Sheila that her boyfriend Ronnie accompanied Kristine to a fancy restaurant last A B night, Sheila told us to mind our own business. C A. accompanyed B. resterant C. business D. No change is necessary.
  • 21. Item 4 I don’t mind sharing a dessert with Matthew, but I must insist on a sepparate fork. A. separate B. seperate C. saperate D. No change is necessary. I don’t mind sharing a dessert with Matthew, but I must insist on a sepparate fork. A. separate B. seperate C. saperate D. No change is necessary. I don’t mind sharing a dessert with Matthew, but I must insist on a sepparate fork. A. separate B. seperate C. saperate D. No change is necessary.
  • 22. Item 5 Professor Williams recommends studing two hours every night; we students wish we had the time but must work to pay for the expensive textbooks that he requires. A. reccomends B. studying C. espensive D. No change is necessary. Professor Williams recommends studing two A B hours every night; we students wish we had the time but must work to pay for the expensive C textbooks that he requires. A. reccomends B. studying C. espensive D. No change is necessary. Professor Williams recommends studying two A B hours every night; we students wish we had the time but must work to pay for the expensive C textbooks that he requires. A. reccomends B. studying C. espensive D. No change is necessary.
  • 23. Item 6 All day long, our new puppy Jack sleeps on the rug, but at night, he is possesed by energy and bounces off the furniture. A. posessed B. possested C. possessed D. No change is necessary. All day long, our new puppy Jack sleeps on the rug, but at night, he is possesed by energy and bounces off the furniture. A. posessed B. possested C. possessed D. No change is necessary. All day long, our new puppy Jack sleeps on the rug, but at night, he is possesed by energy and bounces off the furniture. A. posessed B. possested C. possessed D. No change is necessary.
  • 24. Item 7 Ramón wishs that the lovely Belinda would blow kisses his way, but he is always disappointed. A. wishes B. kissess C. dissappointed D. No change is necessary. Ramón wishs that the lovely Belinda would blow A kisses his way, but he is always disappointed. B C A. wishes B. kissess C. dissappointed D. No change is necessary. Ramón wishes that the lovely Belinda would blow A kisses his way, but he is always disappointed. B C A. wishes B. kissess C. dissappointed D. No change is necessary.
  • 25. Item 8 To please his wife, Robert swept off the roof, even though he found this chore pointless and unnecessary. A. unecessary B. unnecessery C. unneccessary D. No change is necessary. To please his wife, Robert swept off the roof, even though he found this chore pointless and unnecessary. A. unecessary B. unnecessery C. unneccessary D. No change is necessary. To please his wife, Robert swept off the roof, even though he found this chore pointless and unnecessary. A. unecessary B. unnecessery C. unneccessary D. No change is necessary.
  • 26. Item 9 Patrick tried to make Babushka’s potatoe pancakes, but we found them inedible; everyone wished he had made simple French fries instead. A. potato B. ineddible C. frys D. No change is necessary. Patrick tried to make Babushka’s potatoe A pancakes, but we found them inedible; everyone B wished he had made simple French fries instead. C A. potato B. ineddible C. frys D. No change is necessary. Patrick tried to make Babushka’s potato A pancakes, but we found them inedible; everyone B wished he had made simple French fries instead. C A. potato B. ineddible C. frys D. No change is necessary.
  • 27. Item 10 Look at Jonathan’s face turning red—that boy embarasses easily! A. embarrases B. emmbarasses C. embarrasses D. No change is necessary. Look at Jonathan’s face turning red—that boy embarasses easily! A. embarrases B. emmbarasses C. embarrasses D. No change is necessary. Look at Jonathan’s face turning red—that boy embarasses easily! A. embarrases B. emmbarasses C. embarrasses D. No change is necessary.

Hinweis der Redaktion

  1. “hard” vs. “soft” ch = monarch vs. beach