SlideShare ist ein Scribd-Unternehmen logo
1 von 29
Downloaden Sie, um offline zu lesen
Annapurna Poduri, MD, MPH
Epilepsy Genetics Program, Boston Children’s Hospital
Department of Neurology, Harvard Medical School
CFERV Conference | September 13, 2019
Clinical Trials
for Rare Genetic Disorders
© Annapurna Poduri, MD, MPH
Outline
• Translational framework for epilepsy genetics
• Considerations for rare genetic ‘epilepsies’
• N of 1 ‘trials’
© Annapurna Poduri, MD, MPH
Outline
• Translational framework for epilepsy genetics
• Considerations for rare genetic ‘epilepsies’
• N of 1 ‘trials’
© Annapurna Poduri, MD, MPH
Epilepsy Genetics: A Translational Approach
© Annapurna Poduri, MD, MPH
Outline
• Translational framework for epilepsy genetics
• Considerations for rare genetic ‘epilepsies’
• N of 1 ‘trials’
© Annapurna Poduri, MD, MPH
What outcomes should be targeted?
• Seizure
• Epilepsy—more than one unprovoked seizure*
• Epilepsy syndrome
– characteristic features
– other features: developmental delay/intellectual
disability, autism, hypotonia, movement
disorders
© Annapurna Poduri, MD, MPH
What outcomes should be targeted?
• Seizure
• Epilepsy—more than one unprovoked seizure*
• Epilepsy syndrome
– characteristic features
– other features: developmental delay/intellectual
disability, autism, hypotonia, movement
disorders
© Annapurna Poduri, MD, MPH
Epilepsy Genetics: A Translational Approach
?
© Annapurna Poduri, MD, MPH
What do we seek in epilepsy treatments?
• Efficacy—do they work?
– For what core features?
• Tolerability
– Target specific dysfunction, avoid unneeded side
effects
• Benefit/risk balance
• When are clinical trials appropriate?
© Annapurna Poduri, MD, MPH
Outline
• Translational framework for epilepsy genetics
• Considerations for rare genetic epilepsies
• N of 1 ‘trials’
© Annapurna Poduri, MD, MPH
Rationale for pursuing targeted n of 1 therapy:
a ‘simple’ case
Diagnostic certainty:
-2 sibs, compound heterozygous CAD
-MRI progression
-blood smear: anisopoikilocytosis
Risks of not pursuing treatment:
-ongoing seizures/risk of status epilepticus
-developmental regression
Risks of treatment with uridine: theoretical
© Annapurna Poduri, MD, MPH
A year later…
© Annapurna Poduri, MD, MPH
And 2 years later…
© Annapurna Poduri, MD, MPH
And this past Tuesday
© Annapurna Poduri, MD, MPH
10 months from mutation identification to first dosing
4 months from lead to first dosing
Slide courtesy Tim Yu, BCH
Targeted n of 1 therapy:
a complex case with Batten disease
© Annapurna Poduri, MD, MPH
CLN7:
6 7 8 13••••••1
Trapped CLN7:
6 7 8 13••••••1 SVAi6
stop*
Native E6-E7
Mutant E6-i6
Blood RNA → RNA-seq
→ Splice junction analyses
→ RT-PCR confirmation
SVA
?
Slide courtesy Tim Yu, BCH
Targeted n of 1 therapy:
a complex case with Batten disease
© Annapurna Poduri, MD, MPH
Normal CLN7 splicing:
6 7 8 13••••••1
After transposon insertion:
SVA6•••1 i6
stop*
6 7 8
1
3
•
•
•
•
•
•
1 *
S
V
A
i
6
Restoration of
normal splicing
Mila Fibroblasts
Antisense oligos
A patient-specific screen:
Slide courtesy Tim Yu, BCH
Targeted n of 1 therapy:
a complex case with Batten disease
© Annapurna Poduri, MD, MPH
Seizure frequency & intensity
Christelle Achkar, BCH
© Annapurna Poduri, MD, MPH
10 months from mutation identification to first dosing
4 months from lead to first dosing
Slide courtesy Tim Yu, BCH
Targeted n of 1 therapy:
a complex case with Batten disease
© Annapurna Poduri, MD, MPH
NIH Undiagnosed Disease Program
Pierson et al., Annals of Clinical Translational Neurology, 2014
GRIN2A and memantine
© Annapurna Poduri, MD, MPH
NIH Undiagnosed Disease Program
Pierson et al., Annals of Clinical Translational Neurology, 2014
GRIN2A and memantine
© Annapurna Poduri, MD, MPH
Jurriaan Peters, Heather Olson, BCH
New patient with Glu2NA S644G
• Epileptic spasms
• Now ‘standard’ evaluation with gene panel
• Standard treatments not effective
© Annapurna Poduri, MD, MPH
GRIN2A and memantine
LBD
M3
LBD
ATD
M4
M2
*
b GluN1/GluN2A Tetramer
S644
Transmembrane
Domains
Ligand
Binding
Domain
Amino
Terminal
Domain
COOH
GluN2A
Out
In
Agonist
a
Human GluN2A (630) MVSVWAFFAVIFLASYTANLAAFMIQEEFVDQ
GRIN2A
ATD S1 S2 CTDM1
M2
M3 M4
*
*
Steve Traynelis (Emory) © Annapurna Poduri, MD, MPH
100
80
60
40
20
0
S644G
WT 2A
Glutamate, mM
MaximalResponse,%
0.1 1 10 1000.01
a
Figure-2. Functional evaluation of GluN1/GluN2A receptors and GluN1/GluN2A-S644G receptors by
two-electrode voltage clamp recording from Xenopus laevis oocytes. (a) The composite glutamate
(in the presence of 100 mM glycine) and (b) glycine (in the presence of 100 mM glutamate)
concentration-response curves show an increased agonist potency (17-fold for glutamate, 11-fold
for glycine) in the mutant receptors compared to the wild-type (WT) receptors.
The data were expressed as Mean ± SEM (n).* p < 0.05, compared to WT, unpaired t-test.
Table-1. Summary of pharmacological data for S644G
WT 2A 2A-S644G
Glu EC50, mM (n) 3.4 ± 0.40 (6) 0.20 ± 0.0.3 (6)*
Gly, EC50, mM (n) 1.0 ± 0.09 (5) 0.09 ± 0.02 (10)*
Glycine, mM
S644G
WT 2A100
80
60
40
20
0
MaximalResponse,%
b
0.1 1 100.010.001
Steve Traynelis (Emory) © Annapurna Poduri, MD, MPH
New patient with Glu2NA S644G
• 2015 discussion—N of 1 vs. await a trial
• Interim guidelines
• Progress report
© Annapurna Poduri, MD, MPH
What have we learned?
Multi-center trial vs. N of 1 trial
Needs infrastructure +/- infrastructure
Slower Faster
Standardized outcomes Customized outcomes
Randomization possible Non-generalizable
Needed if high risk Better for low risk?
© Annapurna Poduri, MD, MPH
Goal: achieving precision treatment
© Annapurna Poduri, MD, MPH
What have we learned?
• Precision diagnosis
• Risk/benefit discussion
– Disease course/need for treatment
– Meaningful outcomes and how to measure them
– Pre-clinical data re: specific mechanisms, drugs
© Annapurna Poduri, MD, MPH
Thank you
• Patients and families
• Tim Yu, Heather Olson, Jurr Peters, BCH
• Steve Traynelis, Emory
• Wayne Frankel, Columbia
• Tim Benke, Kristen Park, Colorado
• Eric Marsh, Ingo Helbig, CHOP
• International epilepsy genetics
community of collaborators
BCH Epilepsy Genetics Program/Poduri Lab
epilepsygenetics@childrens.harvard.edu © Annapurna Poduri, MD, MPH

Weitere ähnliche Inhalte

Ähnlich wie CFERV 2019 Poduri

Hepatosplenomegaly how do we approach
Hepatosplenomegaly how do we approachHepatosplenomegaly how do we approach
Hepatosplenomegaly how do we approach
Sanjeev Kumar
 
Dr. Boles MitoAction Presentation 9/13/13
Dr. Boles MitoAction Presentation 9/13/13Dr. Boles MitoAction Presentation 9/13/13
Dr. Boles MitoAction Presentation 9/13/13
mitoaction
 
Дипептивен Фрезениус Каби
Дипептивен Фрезениус КабиДипептивен Фрезениус Каби
Дипептивен Фрезениус Каби
Fresenius Kabi
 
Merge Journal Club 2 Background + method.pdf
Merge Journal Club 2 Background + method.pdfMerge Journal Club 2 Background + method.pdf
Merge Journal Club 2 Background + method.pdf
MyThaoAiDoan
 
MSKCC TMA Lecture
MSKCC TMA LectureMSKCC TMA Lecture
MSKCC TMA Lecture
derosaMSKCC
 

Ähnlich wie CFERV 2019 Poduri (20)

Hepatosplenomegaly how do we approach
Hepatosplenomegaly how do we approachHepatosplenomegaly how do we approach
Hepatosplenomegaly how do we approach
 
Dr. Boles MitoAction Presentation 9/13/13
Dr. Boles MitoAction Presentation 9/13/13Dr. Boles MitoAction Presentation 9/13/13
Dr. Boles MitoAction Presentation 9/13/13
 
Clinical Case Study
Clinical Case StudyClinical Case Study
Clinical Case Study
 
Recent advances in GBS
Recent advances in GBSRecent advances in GBS
Recent advances in GBS
 
13. a case study on convulsions in a kco epilepsy with lactational amenorrhoea
13. a case study on convulsions in a kco epilepsy with lactational amenorrhoea13. a case study on convulsions in a kco epilepsy with lactational amenorrhoea
13. a case study on convulsions in a kco epilepsy with lactational amenorrhoea
 
B. miyamotoi はあなたのそばにいる
B. miyamotoi はあなたのそばにいるB. miyamotoi はあなたのそばにいる
B. miyamotoi はあなたのそばにいる
 
Дипептивен Фрезениус Каби
Дипептивен Фрезениус КабиДипептивен Фрезениус Каби
Дипептивен Фрезениус Каби
 
Merge Journal Club 2 Background + method.pdf
Merge Journal Club 2 Background + method.pdfMerge Journal Club 2 Background + method.pdf
Merge Journal Club 2 Background + method.pdf
 
Chakraborty APPI Mumbai 140615
Chakraborty APPI Mumbai 140615Chakraborty APPI Mumbai 140615
Chakraborty APPI Mumbai 140615
 
Study of anticonvulsant activity of quinidine in albino rats using pentylenet...
Study of anticonvulsant activity of quinidine in albino rats using pentylenet...Study of anticonvulsant activity of quinidine in albino rats using pentylenet...
Study of anticonvulsant activity of quinidine in albino rats using pentylenet...
 
MSKCC TMA Lecture
MSKCC TMA LectureMSKCC TMA Lecture
MSKCC TMA Lecture
 
A case of Neuromyelitis optica as a presenting manifestation of Systemic Lupu...
A case of Neuromyelitis optica as a presenting manifestation of Systemic Lupu...A case of Neuromyelitis optica as a presenting manifestation of Systemic Lupu...
A case of Neuromyelitis optica as a presenting manifestation of Systemic Lupu...
 
Case study- Peripheral Neuropathy (Nerve Care forum)
Case study- Peripheral Neuropathy (Nerve Care forum)Case study- Peripheral Neuropathy (Nerve Care forum)
Case study- Peripheral Neuropathy (Nerve Care forum)
 
Stevens Johnson syndrome and laboratory diagnostic tools
Stevens Johnson syndrome and laboratory diagnostic toolsStevens Johnson syndrome and laboratory diagnostic tools
Stevens Johnson syndrome and laboratory diagnostic tools
 
Emergencies In Parkinsonism
Emergencies In ParkinsonismEmergencies In Parkinsonism
Emergencies In Parkinsonism
 
Dr. john millichap kcnq2 Cure summit professional track learn more at kcnq2cu...
Dr. john millichap kcnq2 Cure summit professional track learn more at kcnq2cu...Dr. john millichap kcnq2 Cure summit professional track learn more at kcnq2cu...
Dr. john millichap kcnq2 Cure summit professional track learn more at kcnq2cu...
 
Adjuvant therapy for Renal Cancer
Adjuvant therapy for Renal CancerAdjuvant therapy for Renal Cancer
Adjuvant therapy for Renal Cancer
 
New Treatment Devices and Clinical Trials
New Treatment Devices and Clinical Trials New Treatment Devices and Clinical Trials
New Treatment Devices and Clinical Trials
 
Iop compliance and fluctuations
Iop compliance and fluctuationsIop compliance and fluctuations
Iop compliance and fluctuations
 
Case of Neonatal Hyperparathyroidism.pdf
Case of Neonatal Hyperparathyroidism.pdfCase of Neonatal Hyperparathyroidism.pdf
Case of Neonatal Hyperparathyroidism.pdf
 

Mehr von JillianHastingsWard

CFERV 2019 Hausman-Kedem
CFERV 2019 Hausman-KedemCFERV 2019 Hausman-Kedem
CFERV 2019 Hausman-Kedem
JillianHastingsWard
 
CFERV 2019 Frankel
CFERV 2019 FrankelCFERV 2019 Frankel
CFERV 2019 Frankel
JillianHastingsWard
 
CFERV 2019 Yuan
CFERV 2019 YuanCFERV 2019 Yuan
CFERV 2019 Yuan
JillianHastingsWard
 
CFERV 2019 Roche_kwr
CFERV 2019 Roche_kwrCFERV 2019 Roche_kwr
CFERV 2019 Roche_kwr
JillianHastingsWard
 
CFERV 2019 Wenshu
CFERV 2019 WenshuCFERV 2019 Wenshu
CFERV 2019 Wenshu
JillianHastingsWard
 
CFERV 2019 Ramsey
CFERV 2019 RamseyCFERV 2019 Ramsey
CFERV 2019 Ramsey
JillianHastingsWard
 
CFERV 2019 Helbig
CFERV 2019 HelbigCFERV 2019 Helbig
CFERV 2019 Helbig
JillianHastingsWard
 

Mehr von JillianHastingsWard (11)

GRIN2B survey 2018
GRIN2B survey 2018GRIN2B survey 2018
GRIN2B survey 2018
 
CFERV 2019 Hausman-Kedem
CFERV 2019 Hausman-KedemCFERV 2019 Hausman-Kedem
CFERV 2019 Hausman-Kedem
 
CFERV 2019 Simons Searchlight
CFERV 2019 Simons SearchlightCFERV 2019 Simons Searchlight
CFERV 2019 Simons Searchlight
 
CFERV 2019 Frankel
CFERV 2019 FrankelCFERV 2019 Frankel
CFERV 2019 Frankel
 
CFERV 2019 Yuan
CFERV 2019 YuanCFERV 2019 Yuan
CFERV 2019 Yuan
 
CFERV 2019 Roche_kwr
CFERV 2019 Roche_kwrCFERV 2019 Roche_kwr
CFERV 2019 Roche_kwr
 
CFERV 2019 Wenshu
CFERV 2019 WenshuCFERV 2019 Wenshu
CFERV 2019 Wenshu
 
CFERV 2019 Lemke
CFERV 2019 Lemke CFERV 2019 Lemke
CFERV 2019 Lemke
 
CFERV 2019 Ramsey
CFERV 2019 RamseyCFERV 2019 Ramsey
CFERV 2019 Ramsey
 
CFERV 2019 Helbig
CFERV 2019 HelbigCFERV 2019 Helbig
CFERV 2019 Helbig
 
CFERV 2019 Traynelis
CFERV 2019 TraynelisCFERV 2019 Traynelis
CFERV 2019 Traynelis
 

Kürzlich hochgeladen

Low Rate Call Girls Pune {9xx000xx09} ❤️VVIP NISHA Call Girls in Pune Maharas...
Low Rate Call Girls Pune {9xx000xx09} ❤️VVIP NISHA Call Girls in Pune Maharas...Low Rate Call Girls Pune {9xx000xx09} ❤️VVIP NISHA Call Girls in Pune Maharas...
Low Rate Call Girls Pune {9xx000xx09} ❤️VVIP NISHA Call Girls in Pune Maharas...
Sheetaleventcompany
 
Premium Call Girls Bangalore {7304373326} ❤️VVIP POOJA Call Girls in Bangalor...
Premium Call Girls Bangalore {7304373326} ❤️VVIP POOJA Call Girls in Bangalor...Premium Call Girls Bangalore {7304373326} ❤️VVIP POOJA Call Girls in Bangalor...
Premium Call Girls Bangalore {7304373326} ❤️VVIP POOJA Call Girls in Bangalor...
Sheetaleventcompany
 
Ernakulam Call Girls 👙 6297143586 👙 Genuine WhatsApp Number for Real Meet
Ernakulam Call Girls 👙 6297143586 👙 Genuine WhatsApp Number for Real MeetErnakulam Call Girls 👙 6297143586 👙 Genuine WhatsApp Number for Real Meet
Ernakulam Call Girls 👙 6297143586 👙 Genuine WhatsApp Number for Real Meet
Call Girls Chandigarh
 
Gorgeous Call Girls In Pune {9xx000xx09} ❤️VVIP ANKITA Call Girl in Pune Maha...
Gorgeous Call Girls In Pune {9xx000xx09} ❤️VVIP ANKITA Call Girl in Pune Maha...Gorgeous Call Girls In Pune {9xx000xx09} ❤️VVIP ANKITA Call Girl in Pune Maha...
Gorgeous Call Girls In Pune {9xx000xx09} ❤️VVIP ANKITA Call Girl in Pune Maha...
Sheetaleventcompany
 
visakhapatnam Call Girls 👙 6297143586 👙 Genuine WhatsApp Number for Real Meet
visakhapatnam Call Girls 👙 6297143586 👙 Genuine WhatsApp Number for Real Meetvisakhapatnam Call Girls 👙 6297143586 👙 Genuine WhatsApp Number for Real Meet
visakhapatnam Call Girls 👙 6297143586 👙 Genuine WhatsApp Number for Real Meet
Call Girls Chandigarh
 
Punjab Call Girls Contact Number +919053,900,678 Punjab Call Girls
Punjab Call Girls Contact Number +919053,900,678 Punjab Call GirlsPunjab Call Girls Contact Number +919053,900,678 Punjab Call Girls
Punjab Call Girls Contact Number +919053,900,678 Punjab Call Girls
@Chandigarh #call #Girls 9053900678 @Call #Girls in @Punjab 9053900678
 
Call Girls In Indore 📞9235973566📞Just Call Inaaya📲 Call Girls Service In Indo...
Call Girls In Indore 📞9235973566📞Just Call Inaaya📲 Call Girls Service In Indo...Call Girls In Indore 📞9235973566📞Just Call Inaaya📲 Call Girls Service In Indo...
Call Girls In Indore 📞9235973566📞Just Call Inaaya📲 Call Girls Service In Indo...
Sheetaleventcompany
 
🍑👄Ludhiana Escorts Service☎️98157-77685🍑👄 Call Girl service in Ludhiana☎️Ludh...
🍑👄Ludhiana Escorts Service☎️98157-77685🍑👄 Call Girl service in Ludhiana☎️Ludh...🍑👄Ludhiana Escorts Service☎️98157-77685🍑👄 Call Girl service in Ludhiana☎️Ludh...
🍑👄Ludhiana Escorts Service☎️98157-77685🍑👄 Call Girl service in Ludhiana☎️Ludh...
dilpreetentertainmen
 

Kürzlich hochgeladen (20)

Low Rate Call Girls Pune {9xx000xx09} ❤️VVIP NISHA Call Girls in Pune Maharas...
Low Rate Call Girls Pune {9xx000xx09} ❤️VVIP NISHA Call Girls in Pune Maharas...Low Rate Call Girls Pune {9xx000xx09} ❤️VVIP NISHA Call Girls in Pune Maharas...
Low Rate Call Girls Pune {9xx000xx09} ❤️VVIP NISHA Call Girls in Pune Maharas...
 
Premium Call Girls Bangalore {7304373326} ❤️VVIP POOJA Call Girls in Bangalor...
Premium Call Girls Bangalore {7304373326} ❤️VVIP POOJA Call Girls in Bangalor...Premium Call Girls Bangalore {7304373326} ❤️VVIP POOJA Call Girls in Bangalor...
Premium Call Girls Bangalore {7304373326} ❤️VVIP POOJA Call Girls in Bangalor...
 
Call Now ☎ 8868886958 || Call Girls in Chandigarh Escort Service Chandigarh
Call Now ☎ 8868886958 || Call Girls in Chandigarh Escort Service ChandigarhCall Now ☎ 8868886958 || Call Girls in Chandigarh Escort Service Chandigarh
Call Now ☎ 8868886958 || Call Girls in Chandigarh Escort Service Chandigarh
 
Sexy Call Girl Kumbakonam Arshi 💚9058824046💚 Kumbakonam Escort Service
Sexy Call Girl Kumbakonam Arshi 💚9058824046💚 Kumbakonam Escort ServiceSexy Call Girl Kumbakonam Arshi 💚9058824046💚 Kumbakonam Escort Service
Sexy Call Girl Kumbakonam Arshi 💚9058824046💚 Kumbakonam Escort Service
 
Ernakulam Call Girls 👙 6297143586 👙 Genuine WhatsApp Number for Real Meet
Ernakulam Call Girls 👙 6297143586 👙 Genuine WhatsApp Number for Real MeetErnakulam Call Girls 👙 6297143586 👙 Genuine WhatsApp Number for Real Meet
Ernakulam Call Girls 👙 6297143586 👙 Genuine WhatsApp Number for Real Meet
 
Budhwar Peth ( Call Girls ) Pune 6297143586 Hot Model With Sexy Bhabi Ready...
Budhwar Peth ( Call Girls ) Pune  6297143586  Hot Model With Sexy Bhabi Ready...Budhwar Peth ( Call Girls ) Pune  6297143586  Hot Model With Sexy Bhabi Ready...
Budhwar Peth ( Call Girls ) Pune 6297143586 Hot Model With Sexy Bhabi Ready...
 
Gorgeous Call Girls In Pune {9xx000xx09} ❤️VVIP ANKITA Call Girl in Pune Maha...
Gorgeous Call Girls In Pune {9xx000xx09} ❤️VVIP ANKITA Call Girl in Pune Maha...Gorgeous Call Girls In Pune {9xx000xx09} ❤️VVIP ANKITA Call Girl in Pune Maha...
Gorgeous Call Girls In Pune {9xx000xx09} ❤️VVIP ANKITA Call Girl in Pune Maha...
 
Independent Call Girls Service Chandigarh | 8868886958 | Call Girl Service Nu...
Independent Call Girls Service Chandigarh | 8868886958 | Call Girl Service Nu...Independent Call Girls Service Chandigarh | 8868886958 | Call Girl Service Nu...
Independent Call Girls Service Chandigarh | 8868886958 | Call Girl Service Nu...
 
visakhapatnam Call Girls 👙 6297143586 👙 Genuine WhatsApp Number for Real Meet
visakhapatnam Call Girls 👙 6297143586 👙 Genuine WhatsApp Number for Real Meetvisakhapatnam Call Girls 👙 6297143586 👙 Genuine WhatsApp Number for Real Meet
visakhapatnam Call Girls 👙 6297143586 👙 Genuine WhatsApp Number for Real Meet
 
Independent Call Girls Service Chandigarh Sector 17 | 8868886958 | Call Girl ...
Independent Call Girls Service Chandigarh Sector 17 | 8868886958 | Call Girl ...Independent Call Girls Service Chandigarh Sector 17 | 8868886958 | Call Girl ...
Independent Call Girls Service Chandigarh Sector 17 | 8868886958 | Call Girl ...
 
💞 Safe And Secure Call Girls Coimbatore 🧿 9332606886 🧿 High Class Call Girl S...
💞 Safe And Secure Call Girls Coimbatore 🧿 9332606886 🧿 High Class Call Girl S...💞 Safe And Secure Call Girls Coimbatore 🧿 9332606886 🧿 High Class Call Girl S...
💞 Safe And Secure Call Girls Coimbatore 🧿 9332606886 🧿 High Class Call Girl S...
 
Sexy Call Girl Palani Arshi 💚9058824046💚 Palani Escort Service
Sexy Call Girl Palani Arshi 💚9058824046💚 Palani Escort ServiceSexy Call Girl Palani Arshi 💚9058824046💚 Palani Escort Service
Sexy Call Girl Palani Arshi 💚9058824046💚 Palani Escort Service
 
(Deeksha) 💓 9920725232 💓High Profile Call Girls Navi Mumbai You Can Get The S...
(Deeksha) 💓 9920725232 💓High Profile Call Girls Navi Mumbai You Can Get The S...(Deeksha) 💓 9920725232 💓High Profile Call Girls Navi Mumbai You Can Get The S...
(Deeksha) 💓 9920725232 💓High Profile Call Girls Navi Mumbai You Can Get The S...
 
Punjab Call Girls Contact Number +919053,900,678 Punjab Call Girls
Punjab Call Girls Contact Number +919053,900,678 Punjab Call GirlsPunjab Call Girls Contact Number +919053,900,678 Punjab Call Girls
Punjab Call Girls Contact Number +919053,900,678 Punjab Call Girls
 
❤️Ludhiana Call Girls ☎️98157-77685☎️ Call Girl service in Ludhiana☎️Ludhiana...
❤️Ludhiana Call Girls ☎️98157-77685☎️ Call Girl service in Ludhiana☎️Ludhiana...❤️Ludhiana Call Girls ☎️98157-77685☎️ Call Girl service in Ludhiana☎️Ludhiana...
❤️Ludhiana Call Girls ☎️98157-77685☎️ Call Girl service in Ludhiana☎️Ludhiana...
 
Jaipur Call Girls 9257276172 Call Girl in Jaipur Rajasthan
Jaipur Call Girls 9257276172 Call Girl in Jaipur RajasthanJaipur Call Girls 9257276172 Call Girl in Jaipur Rajasthan
Jaipur Call Girls 9257276172 Call Girl in Jaipur Rajasthan
 
Call Girls In Indore 📞9235973566📞Just Call Inaaya📲 Call Girls Service In Indo...
Call Girls In Indore 📞9235973566📞Just Call Inaaya📲 Call Girls Service In Indo...Call Girls In Indore 📞9235973566📞Just Call Inaaya📲 Call Girls Service In Indo...
Call Girls In Indore 📞9235973566📞Just Call Inaaya📲 Call Girls Service In Indo...
 
🍑👄Ludhiana Escorts Service☎️98157-77685🍑👄 Call Girl service in Ludhiana☎️Ludh...
🍑👄Ludhiana Escorts Service☎️98157-77685🍑👄 Call Girl service in Ludhiana☎️Ludh...🍑👄Ludhiana Escorts Service☎️98157-77685🍑👄 Call Girl service in Ludhiana☎️Ludh...
🍑👄Ludhiana Escorts Service☎️98157-77685🍑👄 Call Girl service in Ludhiana☎️Ludh...
 
Kolkata Call Girls Miss Inaaya ❤️ at @30% discount Everyday Call girl
Kolkata Call Girls Miss Inaaya ❤️ at @30% discount Everyday Call girlKolkata Call Girls Miss Inaaya ❤️ at @30% discount Everyday Call girl
Kolkata Call Girls Miss Inaaya ❤️ at @30% discount Everyday Call girl
 
Kochi call girls Mallu escort girls available 7877702510
Kochi call girls Mallu escort girls available 7877702510Kochi call girls Mallu escort girls available 7877702510
Kochi call girls Mallu escort girls available 7877702510
 

CFERV 2019 Poduri

  • 1. Annapurna Poduri, MD, MPH Epilepsy Genetics Program, Boston Children’s Hospital Department of Neurology, Harvard Medical School CFERV Conference | September 13, 2019 Clinical Trials for Rare Genetic Disorders © Annapurna Poduri, MD, MPH
  • 2. Outline • Translational framework for epilepsy genetics • Considerations for rare genetic ‘epilepsies’ • N of 1 ‘trials’ © Annapurna Poduri, MD, MPH
  • 3. Outline • Translational framework for epilepsy genetics • Considerations for rare genetic ‘epilepsies’ • N of 1 ‘trials’ © Annapurna Poduri, MD, MPH
  • 4. Epilepsy Genetics: A Translational Approach © Annapurna Poduri, MD, MPH
  • 5. Outline • Translational framework for epilepsy genetics • Considerations for rare genetic ‘epilepsies’ • N of 1 ‘trials’ © Annapurna Poduri, MD, MPH
  • 6. What outcomes should be targeted? • Seizure • Epilepsy—more than one unprovoked seizure* • Epilepsy syndrome – characteristic features – other features: developmental delay/intellectual disability, autism, hypotonia, movement disorders © Annapurna Poduri, MD, MPH
  • 7. What outcomes should be targeted? • Seizure • Epilepsy—more than one unprovoked seizure* • Epilepsy syndrome – characteristic features – other features: developmental delay/intellectual disability, autism, hypotonia, movement disorders © Annapurna Poduri, MD, MPH
  • 8. Epilepsy Genetics: A Translational Approach ? © Annapurna Poduri, MD, MPH
  • 9. What do we seek in epilepsy treatments? • Efficacy—do they work? – For what core features? • Tolerability – Target specific dysfunction, avoid unneeded side effects • Benefit/risk balance • When are clinical trials appropriate? © Annapurna Poduri, MD, MPH
  • 10. Outline • Translational framework for epilepsy genetics • Considerations for rare genetic epilepsies • N of 1 ‘trials’ © Annapurna Poduri, MD, MPH
  • 11. Rationale for pursuing targeted n of 1 therapy: a ‘simple’ case Diagnostic certainty: -2 sibs, compound heterozygous CAD -MRI progression -blood smear: anisopoikilocytosis Risks of not pursuing treatment: -ongoing seizures/risk of status epilepticus -developmental regression Risks of treatment with uridine: theoretical © Annapurna Poduri, MD, MPH
  • 12. A year later… © Annapurna Poduri, MD, MPH
  • 13. And 2 years later… © Annapurna Poduri, MD, MPH
  • 14. And this past Tuesday © Annapurna Poduri, MD, MPH
  • 15. 10 months from mutation identification to first dosing 4 months from lead to first dosing Slide courtesy Tim Yu, BCH Targeted n of 1 therapy: a complex case with Batten disease © Annapurna Poduri, MD, MPH
  • 16. CLN7: 6 7 8 13••••••1 Trapped CLN7: 6 7 8 13••••••1 SVAi6 stop* Native E6-E7 Mutant E6-i6 Blood RNA → RNA-seq → Splice junction analyses → RT-PCR confirmation SVA ? Slide courtesy Tim Yu, BCH Targeted n of 1 therapy: a complex case with Batten disease © Annapurna Poduri, MD, MPH
  • 17. Normal CLN7 splicing: 6 7 8 13••••••1 After transposon insertion: SVA6•••1 i6 stop* 6 7 8 1 3 • • • • • • 1 * S V A i 6 Restoration of normal splicing Mila Fibroblasts Antisense oligos A patient-specific screen: Slide courtesy Tim Yu, BCH Targeted n of 1 therapy: a complex case with Batten disease © Annapurna Poduri, MD, MPH
  • 18. Seizure frequency & intensity Christelle Achkar, BCH © Annapurna Poduri, MD, MPH
  • 19. 10 months from mutation identification to first dosing 4 months from lead to first dosing Slide courtesy Tim Yu, BCH Targeted n of 1 therapy: a complex case with Batten disease © Annapurna Poduri, MD, MPH
  • 20. NIH Undiagnosed Disease Program Pierson et al., Annals of Clinical Translational Neurology, 2014 GRIN2A and memantine © Annapurna Poduri, MD, MPH
  • 21. NIH Undiagnosed Disease Program Pierson et al., Annals of Clinical Translational Neurology, 2014 GRIN2A and memantine © Annapurna Poduri, MD, MPH
  • 22. Jurriaan Peters, Heather Olson, BCH New patient with Glu2NA S644G • Epileptic spasms • Now ‘standard’ evaluation with gene panel • Standard treatments not effective © Annapurna Poduri, MD, MPH
  • 23. GRIN2A and memantine LBD M3 LBD ATD M4 M2 * b GluN1/GluN2A Tetramer S644 Transmembrane Domains Ligand Binding Domain Amino Terminal Domain COOH GluN2A Out In Agonist a Human GluN2A (630) MVSVWAFFAVIFLASYTANLAAFMIQEEFVDQ GRIN2A ATD S1 S2 CTDM1 M2 M3 M4 * * Steve Traynelis (Emory) © Annapurna Poduri, MD, MPH
  • 24. 100 80 60 40 20 0 S644G WT 2A Glutamate, mM MaximalResponse,% 0.1 1 10 1000.01 a Figure-2. Functional evaluation of GluN1/GluN2A receptors and GluN1/GluN2A-S644G receptors by two-electrode voltage clamp recording from Xenopus laevis oocytes. (a) The composite glutamate (in the presence of 100 mM glycine) and (b) glycine (in the presence of 100 mM glutamate) concentration-response curves show an increased agonist potency (17-fold for glutamate, 11-fold for glycine) in the mutant receptors compared to the wild-type (WT) receptors. The data were expressed as Mean ± SEM (n).* p < 0.05, compared to WT, unpaired t-test. Table-1. Summary of pharmacological data for S644G WT 2A 2A-S644G Glu EC50, mM (n) 3.4 ± 0.40 (6) 0.20 ± 0.0.3 (6)* Gly, EC50, mM (n) 1.0 ± 0.09 (5) 0.09 ± 0.02 (10)* Glycine, mM S644G WT 2A100 80 60 40 20 0 MaximalResponse,% b 0.1 1 100.010.001 Steve Traynelis (Emory) © Annapurna Poduri, MD, MPH
  • 25. New patient with Glu2NA S644G • 2015 discussion—N of 1 vs. await a trial • Interim guidelines • Progress report © Annapurna Poduri, MD, MPH
  • 26. What have we learned? Multi-center trial vs. N of 1 trial Needs infrastructure +/- infrastructure Slower Faster Standardized outcomes Customized outcomes Randomization possible Non-generalizable Needed if high risk Better for low risk? © Annapurna Poduri, MD, MPH
  • 27. Goal: achieving precision treatment © Annapurna Poduri, MD, MPH
  • 28. What have we learned? • Precision diagnosis • Risk/benefit discussion – Disease course/need for treatment – Meaningful outcomes and how to measure them – Pre-clinical data re: specific mechanisms, drugs © Annapurna Poduri, MD, MPH
  • 29. Thank you • Patients and families • Tim Yu, Heather Olson, Jurr Peters, BCH • Steve Traynelis, Emory • Wayne Frankel, Columbia • Tim Benke, Kristen Park, Colorado • Eric Marsh, Ingo Helbig, CHOP • International epilepsy genetics community of collaborators BCH Epilepsy Genetics Program/Poduri Lab epilepsygenetics@childrens.harvard.edu © Annapurna Poduri, MD, MPH