Pioneer dehradun-english-edition-2021-08-13

1. 20?BD;4
A4C08;8=5;0C8=40B4B
C$$(8=9D;H
=Tf3T[WX) ATcPX[X]U[PcX^]
TPbTSc^$$(_TaRT]cX]9d[h
PX][hSdTc^b^UcT]X]VU^^S
_aXRTbPRR^aSX]Vc^^UUXRXP[SPcP
aT[TPbTS^]CWdabSPh
A8C4AF7?8=C43
6D=0C2?B44:B108;
=Tf3T[WX) BWPWadZW?PcWP]
fW^P[[TVTS[h_^X]cTSPVd]PcP
3T[WX?^[XRTWTPSR^]bcPQ[T
SdaX]VcWT!!]^acWTPbc3T[WX
R^d]P[aX^cb^]CWdabSPh
b^dVWcQPX[X]P]PccT_cc^
daSTaRPbTR^]cT]SX]VcWPcWT
WPbQTT]X]RPaRTaPcTSU^a#($
SPhbQPbTS^]R^]YTRcdaTbP]S
bdaXbTb?PcWP]XbP]PRRdbTS
X]cf^RPbTb¯ _^X]cX]VPVd]
PcWTPSR^]bcPQ[T3TT_PZ
3PWXhPP]SPccT_cc^daSTa
^U^]TA^WXcBWdZ[PSdaX]VcWT
eX^[T]RTX]]^acWTPbc3T[WX
?=BQ =4F34;78
The unsavoury incidents in
the Upper House which led
to a near washout of the
Monsoon Session of
Parliament again brought the
Government and the
Opposition face-to-face on
Wednesday with both the sides
hurling accusations against
each other for damaging coun-
try’s democratic traditions.
The Government fielded
nine senior Ministers at a Press
conference and charged the
Opposition with “pre-planned
agenda “of disruption” and
having “no interest in discus-
sion” and asked the Opposition
to “apologise to the nation”. It
demanded strict action against
the obstructive behaviour of the
Opposition.
“People wait for their issues
to be raised in Parliament. But
Opposition parties do not care
about people, they don’t care
about taxpayers’ money.
Anarchy from streets to
Parliament was Opposition’s
only agenda during the
Monsoon Session. What hap-
pened was condemnable.
Instead of shedding crocodile
tears, they must apologise to
the nation,” said Information
and Broadcasting Minister
Anurag Thakur while address-
ing the joint Press conference.
The conference was attend-
ed by Union Ministers Piyush
Goyal, Dharmendra Pradhan,
Mukhtar Abbas Naqvi,
Prahlad Joshi, Bhupendra
Yadav, Anurag Singh Thakur,
Arjun Ram Meghwal and V
Muraleedharan.
“Some Opposition mem-
bers desecrated the sanctity of
the House by climbing the
sanctum sanctorum (garbha-
griha), namely the table locat-
ed at Well of the House, and
threw the Rule Book at the
Chair. The member of
Parliament who stood on the
table in Parliament was not
only standing on the table
but was trampling upon
Parliamentary ethics. He was
not only throwing a book at
the Chair but was also throw-
ing Parliamentary conduct out
of the House,” said the
Ministers.
Saying that “anti-democ-
ratic and violent behaviour” of
the Opposition during
Parliament Session scripts a
dark chapter in the history of
Indian democracy, the
Government said misbehav-
iour by the Opposition mem-
bers is “a shameful disgrace in
Parliamentary history of India”
and “they must apologise to
the nation”.
The Ministers said the
Opposition had publicly stat-
ed that the Session should be
washed out. “Their intention
was to not let the House con-
duct business,” they said.
@aaSVU]R^acVa]R__VU+8`ge
µ2SSPXVWDSRORJLVHWRQDWLRQIRUWKHLUDFWLRQLQ8SSHU+RXVH¶
D]X^]X]XbcTab?XhdbW6^hP[?aP[WPS9^bWX3WPaT]SaP?aPSWP]1Wd_T]STaHPSPedZWcPa0QQPb=P`eX0]daPVCWPZdaP]S0aYd]APTVWfP[SdaX]VP?aTbb
R^]UTaT]RTX]=Tf3T[WX^]CWdabSPh ?C8
?=BQ =4F34;78
Leaders of several Opposition
parties on Thursday took
out a protest march against the
Government on several issues,
including Pegasus and alleged
manhandling of their MPs in
the Rajya Sabha, with Congress
leader Rahul Gandhi saying the
voice of people was “crushed”
in the House. Former Prime
Minister HD Deve Gowda,
former Union Minister Sharad
Pawar and several top
Opposition leaders regretted
the way the Monson Session
was conducted without giving
an audience to the large num-
ber of Opposition MPs.
The Opposition accused
the Government of deliber-
ately derailing Parliament and
alleged that the Opposition
MPs, including women mem-
bers, were manhandled by
outsiders who were not part of
Parliament security. Pawar has
alleged that outsiders were
called in to manhandle
Opposition leaders, including
women MPs, before the Upper
House was adjourned sine
die.
“In 55 years of my
Parliamentary career, I have
never seen this kind of behav-
iour towards women MPs in
the august House. More than
40 men and women were
brought into the House from
outside. It is painful. It is an
attack on democracy,” Pawar
alleged. In a joint statement,
Opposition leaders con-
demned the “authoritarian
attitude” and “undemocratic
actions” of the Government
and said what had happened
in the Rajya Sabha on
Wednesday was shocking and
an insult to the dignity of the
House and humiliation of the
members.
The Opposition leaders
also called on Rajya Sabha
Chairman M Venkaiah Naidu
and complained against the
alleged manhandling of its
MPs, including women mem-
bers, following which Naidu
conveyed that details are being
minutely examined.
Gowda urged the Centre
and the Opposition to find a
“middle path” to ensure
Parliament’s next session in
November functions properly,
saying being “terribly
adamant” or over enthusiastic
are both dangerous.
?=BQ =4F34;78
The Chandrayaan-2 orbiter
has confirmed the presence
of water molecules (H2O) and
hydroxyl (OH) on the surface
of the moon.
The researchers, who
analysed the data obtained by
the orbiter’s imaging infrared
spectrometre (IIRS), said,
“There is widespread lunar
hydration and unambiguous
detection of OH and H2O sig-
natures on the moon between
29 degrees north and 62
degrees north latitude.”
“The initial data analysis
from IIRS clearly demonstrates
the presence of widespread
lunar hydration and unam-
biguous detection of OH and
H2O signatures between 29
degrees north and 62 degrees
north latitude,” a research paper
published in the journal
Current Science revealed.
The August 10 research
article is authored by former
ISRO chairman AS Kiran
Kunar from the Indian Institute
of Remote Sensing (IIRS)
Dehradun, SAC in
Ahmedabad, UR Rao Satellite
Centre and ISRO headquarters
in Bengaluru.
“Plagioclase-rich rocks
have been found to have high-
er OH or possibly H2O mole-
cules when compared to the
mare regions, which were
found to have more domi-
nance of OH at higher surface
temperature,” the research
paper said.
The Chandrayaan-2 mis-
sion was launched by Indian
Space Research Organisation
(Isro) in July 2019. Vikram lan-
der on-board the mission
crash-landed on the lunar sur-
face just 2.1 km from its desti-
nation in September that year
but the orbiter accompanying
it has been providing useful
information to scientists back
on earth.
According to the
researchers, the formation of
hydroxyl or water molecules
occurs due to a process called
space weathering, which is
when the solar winds blow over
the lunar surface. It was also
observed from the data that the
brighter sunlit highland regions
at higher latitudes of the moon
were found to have higher
hydroxyl or possibly water
molecules.
The Chandrayaan-1 mis-
sion had already confirmed the
presence of water on moon sur-
face but due to limited spectral
coverage, the exact nature of
hydration could not be ascer-
tained. However, the IIRS on-
board Chandrayaan-2 moon
mission has been able to com-
pletely characterise lunar
hydratioon attributed to the
presence of OH and H2O.
A successful moon landing
would have made India the
fourth country in the world to
land a rocket on the moon after
the US, the erstwhile USSR,
and China, and the first to have
landed close to the lunar South
Pole. On September 24, 2009,
NASA announced that the M3
instrument had detected water
ice on the Moon.
CWXb_W^c^VaP_WaT[TPbTSQhcWT8]SXP]B_PRTATbTPaRWaVP]XbPcX^]8BAbW^fb6T^bh]RWa^]^dbBPcT[[XcT;Pd]RWETWXR[T
6B;E5 RPaahX]V4BP]4PacWQbTaePcX^]bPcT[[XcTcPZX]V^UUUa^BPcXbW3WPfP]B_PRT2T]caTX]BaXWPaXZ^cP^]
CWdabSPh0]8]SXP]a^RZTcUPX[TSX]XcbPccT_c^]CWdabSPhc^_dcPbPcT[[XcTX]c^^aQXcc^_a^eXSTaTP[cXTXPVTbdbTSc^
^]Xc^aRhR[^]TbP]S^cWTa_^cT]cXP[]PcdaP[SXbPbcTab 8BA
?=BQ =4F34;78
The official Twitter handle of
the Congress and that of a
large number of its leaders
and workers have been blocked
by the microblogging plat-
form, which said they have
been blocked for violating the
rules.
The development comes
after twitter blocked Congress
leader Rahul Gandhi’s Twitter
handle after he shared pictures
of the family of a nine-year-old
alleged rape-and-murder vic-
tim in Delhi last week in vio-
lation of laws.
The Twitter accounts of
AICC general secretaries KC
Venugopal, Ajay Maken, party’s
whip in the Lok Sabha
Manickam Tagore, Assam in-
charge and former Union
Minister Jitendra Singh and
Mahila Congress president
Sushmita Dev and Surjewala
also have been blocked.
Twitter said the blocking of
the accounts was done to pro-
tect individual privacy and
safety after they posted images
that violated its rules. The
grand old party accused the
website of acting against Rahul
Gandhi’s account under pres-
sure from the Government.
Congress chief spokesper-
son Randeep Surjewala said the
Narendra Modi Government
will not be able to suppress
their voice by threatening
Twitter.
?C8 Q 07430103
The Indian Air Force has
sacked one of its person-
nel from service for refusing
to get vaccinated against
Covid-19, which has been
made a service condition, the
Central Government has told
the Gujarat High Court.
Additional Solicitor
General Devang Vyas, in his
submission on Wednesday in
the High Court on a plea
moved by Indian Air Force
corporal Yogendra Kumar at
Jamnagar in Gujarat, told a
division bench of Justices AJ
Desai and AP Thaker that
across India, nine personnel
had refused to get vaccinated
and they were given show-
cause notices.
One of them, who did not
respond to the notice, was ter-
minated from service, Vyas
told the high court.
He, however, did not give
the name or any other details
of the staffer against whom
the action was taken.
80=B Q :01D;
The Afghan Government
has offered the Taliban a
share in power so long as the
rising violence in the country
comes to a halt, Al Jazeera
reported on Thursday, citing a
Government source.
The proposal was delivered
through Qatar, the host of
Afghan peace talks, according
to the source.
In another development,
the head of the High Council
for National Reconciliation
(HCNR), Abdullah Abdullah,
presented to the members of
Troika-plus the scheme of
Afghan government for wind-
ing up the ongoing war in
Afghanistan.
Abdullah said the Afghan
Government is committed to
end the ongoing conflicts
through negotiations.
The head of HCNR was
addressing the representatives
of the US, China, Pakistan and
Russia in the Troika-plus meet-
ing held in Doha on
Wednesday evening.
BC055A4?AC4AQ =4F34;78
Two wanted criminals were
killed in an encounter with
the Delhi Police in northeast
Khajuri Khas on Thursday.
Police recovered two auto-
matic pistols, four magazines,
a huge quantity of ammuni-
tion with live rounds and
cash worth C1 lakh from the
possession of the accused.
The duo has been identi-
fied as Amir Khan and
Ramjan. Police said Khan, a
resident of Loni in Ghaziabad,
was previously involved in
seven criminal cases while
his associate Rajman, a resi-
dent of Wazirpur Industrial
Area, was involved in five
criminal cases.
According to Sanjay
Kumar Nain, the Deputy
Commissioner of Police
(DCP), Northeast district, on
the night of Wednesday, the
Station House Officer (SHO)
of Khajuri Khas police station
received specific inputs about
the presence of wanted crim-
inals in Shri Ram Colony in
Khajuri Khas area.
?=B Q =4F34;78
Within the next few years,
as the SARS-CoV-2 virus
becoming endemic, Covid-19
may behave like other com-
mon-cold coronaviruses,
affecting mostly young children
who have not yet been vacci-
nated or exposed to the virus,
according to new modeling
results.
The observation comes at
a time when the USA is report-
ing a growing number of chil-
dren contracting Covid-19,
with a corresponding spike in
cases of respiratory syncytial
virus (RSV), a contagious sea-
sonal flu that is more common
in the winter time.
However, because Covid-
19 severity is generally lower
among children, the overall
burden from this disease is
expected to decline.
“Following infection by
SARS-CoV-2, there has been a
clear signature of increasingly
severe outcomes and fatality
with age,” said Ottar Bjornstad,
researcher from Pennsylvania
State University.
“Yet, our modeling results
suggest that the risk of infection
will likely shift to younger
children as the adult commu-
nity becomes immune either
through vaccination or expo-
sure to the virus,” said the
team’s results which appeared
in the journal Science Advances.
Bjornstad explained that
such shifts have been observed
in other coronaviruses and
influenza viruses as they have
emerged and then become
endemic.
“For example, ongoing
genomic work suggests that the
1889-1890 pandemic, some-
times known as the Asiatic or
Russian flu — which killed one
million people, primarily adults
over age 70 — may have been
caused by the emergence of
HCoV-OC43 virus, which is
now an endemic, mild, repeat-
infecting cold virus affecting
mostly children ages 7-12
months old,” he said.
KDQGUDDDQILQGV
ZDWHURQ0RRQVXUIDFH
Ac`SVda`ed@9
R]d`hZeY^fTY
acVTZdV]`TReZ`_
___a^cTbcPaRWPVPX]bc
b_hX]V?b´ P]WP]S[X]V
2^]VaTbb[TPSTaAPWd[6P]SWXP]S[TPSTab^U^cWTa__^bXcX^]_PacXTbPcP_a^cTbc
PaRW^]?Pa[XPT]c_aTXbTbX]=Tf3T[WX^]CWdabSPh ?C8
2W8`ge`WWVcdER]ZSR_
µdYRcVZ_a`hVc¶eZ]]
eYVjdYf_gZ`]V_TV
:_WVTeZ`_e`V_U
]ZVV_UV^ZT+
CVdVRcTYdefUj
ARcej]VRUVcdTcj
W`f]dRjEhZeeVc
RTeZ_Xf_UVc
8`geacVddfcV
:27dRTd
deRWWVcW`c
cVWfdZ_Xe`
eRVdY`e
Eh`hR_eVU
TcZ^Z_R]d
Z]]VUZ_5V]YZ
V_T`f_eVc
?T^_[T[X]Td_c^VTcX]^Rd[PcTSPVPX]bc2^eXS (^dcbXSTPePRRX]PcX^]RT]caTX]
dQPX^]CWdabSPh 0?
0QSd[[PW0QSd[[PWRT]caT[TUcfW^
WTPSbcWT0UVWP]6^eTa]T]c´b
aTR^]RX[XPcX^]R^d]RX[PaaXeTbU^acP[Zb
X]3^WP^]CWdabSPh 0?
CfXccTaQ[^RZb2^]V´b
WP]S[T[TPSTab´PRb
U^aU[^dcX]VXcbad[Tb
RYLGULVNPDVKLIW
WRRXQJHUFKLOGUHQ
/CWT3PX[h?X^]TTa UPRTQ^^ZR^SPX[h_X^]TTa
7`]]`hfd`_+
fffSPX[h_X^]TTaR^
X]bcPVaPR^SPX[h_X^]TTa
;PcT2Xch E^[ $ 8bbdT !!
0XaBdaRWPaVT4gcaPXU0__[XRPQ[T
?dQ[XbWTS5a^
34;78;D2:=F 17?0;17D10=4BF0A
A0=278A08?DA 270=3860A7
347A03D= 7H34A0103E890HF030
4bcPQ[XbWTS '%#
51,1R5HJQ877(1*5(*'1R8$'2''1
347A03D=5A830H0D6DBC !! *?064B !C!
DA@CE#
A78CA07D;A468BC4AE4A
AD=?4=8=6BC0=3
m
m
H@C=5)
DBB44B?0:DB45D;=;H5A
2;40A8=64BB8=05)8A0=
91=F5BI
C563B9D931*
21:@1I55
! F9F139DI
@A:?:@?'
64CE4C?F4A
A1830384DCD=

2. ]PcX^]!
347A03D=k5A830H k0D6DBC !!
$OWKRXJKHYHUSRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHOIRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULWRIRUELQGLQJLQDQZDRQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQUHVSRQVLELOLWIRUDQ
GDPDJHRUORVVWRDQSHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQDFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULIDQGVHHNDSSURSULDWHDGYLFHWRVDWLVIWKHPVHOYHVDERXWWKHYHUDFLWRIDQNLQGRIDGYHUWLVHPHQWEHIRUH
UHVSRQGLQJWRDQFRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQHPSORHHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQNLQGRIFODLPPDGHEWKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQNLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV
?=BQ =4FC47A8
The protest by Char Dham
Teerth Purohits demanding
dissolution of Char Dham
Devasthanam Board is contin-
uing unabated at Kedarnath
and other places.
Teerth Purohit Santosh
Trivedi recently wrote a letter
with his blood to Prime
Minister Narendra Modi seek-
ing the dissolution of the board
to protect the interests of the
Teerth Purohits.
The Dharna has continued
near the Gangotri, Kedarnath
and Badrinath shrines against
Devasthanam board. It may be
recalled that since the forma-
tion of Devasthanam Board,
the Teerth Purohits of the Char
Dham shrines of Gangotri,
Yamunotri, Kedarnath and
Badrinath have been opposing
the move. They have met the
successive Chief Ministers and
other other ministers demand-
ing the dissolution of the board,
but instead of dissolving the
board, it is being expanded.
It may be mentioned that
about two years ago, the
Devasthanam Board was con-
stituted under the leadership of
the then CM Trivendra Singh
Rawat. The management of a
total of 51 temples including
the Char Dham shrines was
brought under the purview of
the board.
Recently, chief minister
Pushkar Singh Dhami has
talked of a high-power com-
mittee to be constituted to
address the issue. Gangotri
temple committee secretary
Deepak Semwal said that if the
high-power committee does
not act on the demands by
August 15, the Teerth Purohits
will intensify their agitation.
EVVceYAfc`YZede`
Z_eV_dZWjac`eVdeRXRZ_de
5VgRdeYR_R^3`RcU
?=BQ 270=3860A7
Out of six projects worth Rs
1565 crore sent by
Haryana Government during
the current financial year 2021-
22, the National Bank for
Agriculture and Rural
Development (NABARD) has
sanctioned three projects with
loan amount of Rs 737 crore
while other three are still under
consideration.
Theseincludeprojectsofthe
Public Health and Engineering
Department, Public Works
Department (Building and
Roads), Irrigation and Water
Resources Department, Food
and Civil Supplies Department,
HAREDA. This was informed
during the review meeting
presided over by Chief Minister
Manohar Lal Khattar regarding
various projects that are being
funded by NABARD.
He said that Haryana is
among the leading states in the
country in terms of getting
more financial assistance from
National Bank for Agriculture
and Rural Development
(NABARD)intheyear2020-21,
despiteCOVID-19pandemic.In
thelastfinancialyearof2020-21,
the State has received 44 percent
more financial assistance from
NABARD as compared to the
financial year 2019-20.
1$%$5'VDQFWLRQVORDQRICFU
IRUWKUHHSURMHFWVLQ+DUDQD
?=BQ 270=3860A7
To curtail rampant hookah
smoking, especially in the
rural areas of the state, Haryana
Government will formulate an
effective Information,
Education and
Communication (IEC) strate-
gy besides offering incentives to
quit smoking.
The directions in this
regard were issued by Haryana
Additional Chief Secretary,
Health, Rajeev Arora during
the review meeting of the State
Level Coordination Committee
(SLCC). He directed the offi-
cials concerned to formulate a
strategy so as to motivate peo-
ple to discontinue the con-
sumption of such tobacco
products.
The ACS Health also
directed to start giving incen-
tives to tobacco consumers for
quitting and to initiate such
programmes in schools and
colleges. Along with this, sim-
ilar incentives should be given
in rural areas like declaring
tobacco-free Panchayats, he
added.
During the COVID-19
pandemic, the State
Government had earlier
requested the people in rural
parts of Haryana to stop gath-
erings for hookah smoking to
contain the spread of infection.
Arora asked officials to
counsel and convince the reg-
ular tobacco consumers regard-
ing its harmful effects other
than implementing IEC activ-
ities. Besides this, he also asked
the officials to unmask the
myths regarding hookah
among the people.
The ACS Health said that
there is a culture of admiring
the people who consume
hookah in rural areas which
needs to be stopped through
effective IEC activities like out-
door advertising, airing catchy
jingles on radio, display of
statutory warnings etc.
7PahP]P6^ecc^U^ad[PcT
bcaPcTVhc^RdacPX[W^^ZPW
b^ZX]VX]BcPcT
?=BQ 270=3860A7
Haryana Chief Minister
Manohar Lal Khattar on
Thursday inaugurated 40 new
soil testing laboratories set up at
the block level in the state. The
soil testing labs have been set up
under the State Government’s
‘Har Khet Swasth Khet’.
In the first phase, soil test-
ing of 25 lakh acres of land will
be done this year through these
laboratories.
Union Minister of State,
Krishan Pal Gujjar, State
Ministers, MPs and MLAs also
joined the programme through
video conferencing.
After the virtual inaugura-
tion,theChiefMinistersaidthat
the State Government is leaving
no stone unturned to realize
PrimeMinisterNarendraModi's
visionofdoublingtheincomeof
farmers. Forthis,soiltestinglab-
oratories have been set up in the
state so that the farmers can be
made aware about which crop
shouldbesownbasedonthesoil
health, he said.
The Chief Minister said
that in the next three years, the
soil testing of the entire 75 lakh
acres of agricultural land in
Haryana will be done.
He said that Haryana has
made a significant contribu-
tion to the national food grains
pool. During the green revolu-
tion period, the farmers of
Haryanafulfilledtheshortageof
food grains in the country by
producing the grains in abun-
dance.
Today paying attention to
the quantity as well as quality of
food grains production has
become the need of the hour, he
added.
Calling upon the farmers to
move towards organic and nat-
ural farming, the Chief Minister
said that by doing so, farmers
would play an important role in
thepreventionofdiseasesdueto
food products.
It was informed that during
this financial year, two soil test-
ing laboratories located at
Panchkula and Karnal have
been proposed to get accredita-
tion from National
Accreditation Board for Testing
and Calibration Laboratories
(NABL).Withthis,Haryanawill
be the first state in India to have
NABLaccreditationoflandtest-
ing laboratories.
B03BP]hdZcY^X]WP]SfXcW[XZTX]STS
_PacXTbc^fX_T^dcUPX[h_^[XcXRbX]?d]YPQ
?=BQ 270=3860A7
Taking a step forward
towards bringing pan-
thak, political, social and
economic change in
Punjab, the Shiromani
Akali Dal (Sanyukt), along
with many other national
and regional parties, on
Thursday joined hands to
form a third front to take
on the Congress and the
Badals in the ensuing state
assembly polls.
Coming together
under one umbrella, they
vowed to give a tough
fight to the “family poli-
tics” in Punjab.
The leaders, who
addressed the media to
announce the alliance
with Akali Dal (Sanyukt)
led by Sukhdev Singh
Dhindsa and Jathedar
Ranjit Singh Brahmpura,
include Aazad Samaj Party
(Kanshiram) patron and
sister of late Babu Kanshi
Ram Swaran Kaur, Bhim
Army national president
Chandra Shekhar Azad,
Shiromani Akali Dal
(Kirti) president Buta
Singh Ransee K, Janata
Dal (Secular) Deve
Gowda state president
Master Avtar Singh, Janata
Dal-United state presi-
dent Manvinderpal Singh
Benipal, Indian Union
Muslim League
(Banatwala) Coordination
Committee national sec-
retary Maqsood-ul-Haq.
Brahmpura said that
for their party, panth is
supreme but unfortunate-
ly, some anti-panthak and
anti-Punjab forces are
working to undermine the
Sikh spirit and ethical and
religious values of Punjab.
Hence, people are des-
perately wishing for a
third alternative front who
can give a tough fight to
the family politics in
Punjab.
He said that the Badal
family had not only done
a great disservice to the
Sikh faith but had also
badly damaged the decen-
cy of the Akal Takht.
“There is no one above the
Akal Takht Sahib and
Jathedar of Shri Akal
Takhat Sahib but as
Deputy Chief Minister of
the state, Sukhbir Singh
Badal had summoned
Akal Takht Jathedar and
even passed an order to
forgive those involved sac-
rilege of Sri Guru Gobind
Singh Ji is a heinous act,”
he said.
Brahmpura clarified
that now is the time to
remove the dominance of
the Badal family from the
Shiromani Akali Dal,
Shiromani Gurdwara
Parbandhak Committee,
and Sri Akal Takht Sahib
and again the customs of
Akal Takhat Sahib and
principle should be
restored.
Dhindsa said that
today, the Badals have
taken the place of the
mahants who at one time
treated Gurdwara as their
jagirs (their own proper-
ty) and misused the power
assigned to them.
“Now, the right time
has come that the Sikh
panth should teach a les-
son to the Badals just like
mahants were taught and
the Badal family should be
shown doors,” said
Dhindsa.
He said that today,
there is a need for the
entire Sikh community to
come together under the
banner of SAD (Sanyukt),
a party that upholds the
true principles of Akali
Dal, and create a new
image of Shiromani Akali
Dal.
“On behalf of SAD
(Sanyukt), he would assure
that the dominance of the
Badal family over the cen-
tury-old Akali Dal would
be ended by liaising with
all panthak peers and well-
wishers of Punjab as the
Badals had tarnished the
image of the party which
has a glorious history of
many supreme sacrifices,”
he said.
“Coming together of
all these regional parties
having the same panthak
ideology is the need of the
hour so as to remove the
traditional parties from
power and to create a third
strong front to bring about
change as per the wishes of
the people of the state,” he
said.
“This alliance is their
first step taken in this
direction and this alliance
would represent Punjab,
Punjabi and Punjabiyat in
the state and build a pros-
perous Punjab,” he said.
Dhindsa said that free-
ing Punjab from the
clutches of various mafias
currently operating in
Punjab is the utmost pri-
ority of this alliance.
“Besides, our party would
also ensure that the invest-
ment in the education sec-
tor the State would be sys-
tematically increased and
the industry which had
disappeared from Punjab
due to increased corrup-
tion in the government
machinery that functioned
under Akali Dal, and now
Congress would be
brought back on track,” he
added.
BC055A4?AC4AQ =4F34;78
Delhi deputy chief minister
Manish Sisodia on
Thursday said that he has writ-
ten to Union health minister
Mansukh Mandaviya stating it
is difficult to find out deaths
related to oxygen scarcity.
“Delhi recorded 25,000
Covid -19 deaths but it is not
known how many deaths
occurred due to lack of oxy-
gen,” Sisodia said.
He said that the Centre
should cooperate in investi-
gating the deaths due to lack of
oxygen and the union govern-
ment should approve the inves-
tigation committee constituted
by the city government.
“It would be wrong to
assume that there were no
deaths due to lack of oxygen
during the second wave of
COVID-19 in Delhi. We have
to admit that there have been
deaths due to the lack of oxy-
gen in Delhi,” he added.
Earlier, Sisodia had said
that the Central Government,
adopting a very irresponsible
and insensitive attitude, refused
to accept that there were any
deaths due to lack of oxygen in
the country.
It is pivotal to mention here
that while the Delhi govern-
ment had formed a high-level
inquiry committee of health
experts to investigate the deaths
due to lack of oxygen and pro-
vide a compensation of Rs. 5
lakh to the victim's family, the
Central Government had dis-
missed the Committee through
the LG.
“Delhi government is ready
to investigate the deaths that
occurred due to the lack of oxy-
gen and this investigation will
be done with full responsibili-
ty,” Sisodia said and appealed to
the Central government that
this time the LG should not dis-
miss the inquiry committee,
but cooperate with city gov-
ernment in investigating the
deaths due to lack of oxygen.
The Delhi government had
in June formed a four-member
expert committee to look into
the deaths due to the shortage
of oxygen during the second
wave of the COVID-19 pan-
demic. Sisodia had subse-
quently said the Centre denied
approval to the committee.
Last month, Opposition
parties had hit out at the gov-
ernment for informing
Parliament that no deaths due
to oxygen shortage were specif-
ically reported by states and
Union Territories during the
second COVID-19 wave.
'HOKLUHFRUGHG
RYLGGHDWKV6LVRGLD
BC055A4?AC4AQ =4F34;78
The Delhi Government will
launch the Health
Information Management
System (HIMS) in 2022, Chief
Minister Arvind Kejriwal said
on Thursday after reviewing its
progress. Delhi government’s
ambitious HIMS – eHealth
card will contain all medical
information of Delhi residents.
CM Kejriwal said,
“Timelines for the HIMS pro-
ject must be expedited to
ensure that people can access
the best of the medical facilities
and get freedom from their
woes.”
According to Delhi gov-
ernment officials, the vendor
selection and bidding process
for the HIMS project complete
and rapid preparations are tak-
ing place.
Terming HIMS imple-
mentation a monumental step
claiming the people of Delhi
freedom from
their problems
related to hospital visits/ med-
ical history etc.…, Delhi gov-
ernment said the project will
bring about a revolution in the
healthcare infrastructure of
Delhi and make health man-
agement seamless; levelling it
with the standards of developed
countries. “Health Cards will be
assigned to each citizen, which
will be a repository of medical
information. Doctors will be
able to see patient’s medical his-
tory using the card and the
patients will be able to take
appointments from home,” said
a government official.
The Delhi government will
also conduct a survey to make
eHealth cards. While the entire
system will be digital, people
will not have to stand for long
in hospitals with online
appointment systems. A cen-
tralized call center will be set
up.
'HOKL*RYWZLOOODXQFK+HDOWK,QIRUPDWLRQ
0JPW6VWHPLQ.HMULZDO
7PahP]P2WXTUX]XbcTa
X]PdVdaPcTb#]Tfb^X[
cTbcX]V[PQbX]BcPcT
CWT2WXTUX]XbcTa
bPXScWTBcPcT
6^eTa]T]cXb
[TPeX]V]^bc^]T
d]cda]TSc^aTP[XbT
?aXTX]XbcTa
=PaT]SaP^SXb
eXbX^]^US^dQ[X]VcWT
X]R^T^UUPaTab
BC055A4?AC4AQ =4F34;78
In line of the ‘World Skills
Competition’, popularly
known as the ‘Olympics of
Skills’ being hosted in
Shanghai in 2022, the India
Skills Competition will be
held this year in the national
capital and individuals from
over 20 states will be partici-
pating and the winning team
will represent India in
Shanghai, Deputy Chief
Minister Manish Sisodia said
on Thursday.
Sisodia said, “On one
hand, we are seeing the emer-
gence of 21st century skills
while on the other hand, our
traditional skill sector has
seen a massive boom in tech-
nology. Delhi Government
has decided that our talented
students of Delhi will partici-
pate in the Skill Olympics in
Shanghai and represent India.
To reinforce skilling in our
youth, Delhi Skills and
Entrepreneurship University
(DSEU) will be training some
students for the World Skills
Competition or the ‘Skill
Olympics’.”
“I am happy to announce
that this will be the first time
that a Skill Competition will be
taking place in Delhiand the
DSEU will be organizing this,”
he said.
The deputy CM further
said, “State-level skill compe-
titions will be organised in
Delhi and then selected can-
didates will be participating at
the national level skill com-
petition after which the win-
ning students will go to
Shanghai. Children who will
be selected for National and
International level Skill
Olympics will be trained by
Delhi Skills and
Entrepreneurship University.”
,QGLD6NLOOVRPSHWLWLRQ
WREHKHOGLQ'HOKL
BC055A4?AC4AQ =4F34;78
The Delhi Police on
Thursday said that a 46-
year-old man, accused of
preparing and supplying
bombs during northeast Delhi
riots, was allegedly framed by
his neighbour in Loni,
Ghaziabad over an old enmi-
ty.
According to police, when
the Special Cell unit of Delhi
Police was investigating a case
regarding conspiracy of riots
took place in February 2020,
they received a specific inputs
that one Ansar Khan, a resi-
dent of Kardampuri in north-
east Delhi, was indulged in
riots in February 2020.
“As per information by
source, Khan and his son
Imran were active participant
in Delhi riots and had prepared
bombs during riots and still
preparing more and more for
disturbing communal harmo-
ny. After flaring up the riots in
the area of Kardampuri, they
fled from area in June 2020, as
questioning and apprehension
of local miscreants and rioters
of Kardampuri area gained
momentum in May and June
2020. He was staying some-
where at Loni in Ghaziabad,
UP,” said a senior police offi-
cial.
“Thereafter, Khan, whose
present address was Vijay
Nagar Colony, Loni,
Ghaziabad, was apprehended
from Nithora Road, Aman
Garden, Loni on July 31. He
was examined for the verifica-
tion of secret information.
Khan did not cooperate in the
investigation. He was found
suspicious, but did not disclose
anything. For further enquiry
and to check facts of the infor-
mation, Khan was taken to his
house in Vijay Nagar Colony
for search of the premises,” he
said. “During the search, one
old, yellowish color with stains
of primer, rusty cylindrical
container of primer was found
on the terrace of the house. It
was found to be containing five
sealed iron pipes wrapped in
papers. Each iron pipe was
sealed with the help of iron
bolts and white thread. Also,
one thread was popping out
from the middle of the iron
pipe and Black colour tape was
wrapped around that area. The
pipes were carrying unusual
heavy weight and seems to be
an iron pipe bomb.
They were seized and
deposited in the Malkhana of
Special Cell police station,”
said police official.
“Khan denied having
knowledge of the bombs and it
was observed that some of the
facts were not in sync with the
flow of information. During
further examination, it was
found that one Mujammil Alvi
(36), a resident of Vijay Nagar
Colony, Near Aman Garden,
Loni, Ghaziabad, had some
enmity with Khan in the past
and there was some family
feud going between them,” said
police official.
UROGPDQDFFXVHGLQ'HOKLULRWV
IUDPHGEQHLJKERXUVLQ*]E3ROLFH
3ULQWHGDQGSXEOLVKHGE$MLW6LQKDIRUDQGRQEHKDOIRI0.3ULQWHFK/WGSXEOLVKHGDW8QLJDWH*HQHUDO0HGLD3YW/WG2OG1HKUXRORQ2SS8WWDUDNKDQG-DO6DQVWKDQ'KDUDPSXU'HKUDGXQ3K0RE DQGSULQWHGDW$PDU8MDOD3XEOLFDWLRQV/WG3ORW1R+WR+6HODTXL,QGXVWULDO
$UHD'HKUDGXQ8WWDUDNKDQG(GLWRUKDQGDQ0LWUD$,5685+$5*(RI5H(DVWDOFXWWD5DQFKL%KXEDQHVZDU1RUWK/HK:HVW0XPEDL $KPHGDEDG6RXWK%DQJDORUH KHQQDLHQWUDO.KDMXUDKR'HOKL2IILFH1R%HKLQG*XODE%KDZDQ %DKDGXU6KDK=DIDU0DUJ1HZ'HOKL3KRQH
RPPXQLFDWLRQ2IILFH)6HFWRU12,'$*DXWDP%XGK1DJDU83
3KRQH /XFNQRZ2IILFHWK)ORRU6DKDUD6KRSSLQJHQWUH)DL]DEDG5RDG/XFNQRZ7HOHSKRQHV

3. dccPaPZWP]S
347A03D=k5A830H k0D6DBC !!
5024502034
CWTbXcdPcX^]^U_Ta_[TgXchX]Q^cWcWT
_^cT]c_^[XcXRP[U^aRTbX]DccPaPZWP]ScWT
19?P]S2^]VaTbbR^]cX]dTb^eTacWTUPRT
fXcWfWXRWcWThf^d[ST]cTacWTQPcc[TUXT[S
^UPbbTQ[hT[TRcX^]b^UcWThTPa!!!
CWT_aTSXRPT]c^UcWTbPUUa^]_PachX]cWT
bcPcT^eTacWTXbbdT^U[TPSTabWX_RPTc^
U^aTaTRT]c[hfWT]^]T^UcWT]PcX^]P[
VT]TaP[bTRaTcPaXTbP]SX]RWPaVT^UcWT
_PachX]DccPaPZWP]SbcPcTScWPccWT19?
f^d[SUXVWccWTd_R^X]VPbbTQ[hT[TRcX^]b^]XcbbhQ^[²;^cdb³P]S
]^c^]P]hUPRT7Xb_a^R[PPcX^]fPb`dXRZ[hR^d]cTaTSQhcWT_aTbXST]c
^UcWTbcPcTd]XcfW^PbbTacTScWPccWTh^d]VRWXTUX]XbcTa3WPXf^d[S
QTcWTUPRT^UcWT_PachX]cWTT[TRcX^]bCWTSX[TPX]19?Xb
d]STabcP]SPQ[TbX]RTXcWPbPQPccTah^UcP[[[TPSTabQ^cWX]SXVT]^dbP]S
X_^acTSX]XcbU^[SP]SXcWPbRWP]VTS2bX]cWTbcPcTPccWTSa^_^U
cWTWPc0bXX[PaR^]UdbX^]^eTa[TPSTabWX__aTePX[bX]cWT^__^bXcX^]
2^]VaTbbfWXRWXbThTX]VPR^TQPRZc^cWT_^fTaX]cWTbcPcTCW^dVW
cWT_PachWXVWR^P]SWPbeXacdP[[hQ^fTSS^f]QTU^aTcWTXVWch
7PaXbWAPfPcQhPZX]VWXPbcWTWTPS^UcWTT[TRcX^]RP_PXV]
R^XccTTP]SP]^X]cX]VWXb_a^c|V|Pb?22_aTbXST]cXcWPbaTUaPX]TS
Ua^PbbTacX]VcWPcAPfPcf^d[SQTXcbUPRTX]T[TRcX^]b
B055A=C8;DB.
0X]XbcTa^UcWT3WPXRPQX]TcQTRPTUdaX^dbaTRT]c[hfWT]bRaXQTb
b^dVWcWXbaTPRcX^]c^cWT2^]VaTbb_PachbP[[TVPcX^]cWPcaP_P]c
]T_^cXb_aTePX[TSX]cWTbT[TRcX^]_a^RTbb^UcWT_aTbcXVX^dbCX[dAPdcT[X
PfPaSbCWTX]XbcTafPbXUUTSQTRPdbTWXbSPdVWcTafPb^]T^UcWT
aTRX_XT]cb^UcWTPfPaSVXeT]c^f^T]fW^TgRT[[TSX]SXUUTaT]cRW^bT]
UXT[Sb7TPbbTacTScWPcWXbSPdVWcTaXbeTahcP[T]cTSP]SWPaSf^aZX]VP]S
Ud[[hSTbTaeTScWTPfPaS8]cTaTbcX]V[hcWT[Xbc^U!!bT[TRcTSU^acWT
PfPaS]PTSPUcTaP cWRT]cdahUTP[TfPaaX^afW^XbR^]bXSTaTSPbP
bhQ^[^Uf^P]_^fTaX]DccPaPZWP]SWPbP]hfW^fTaTR^]]TRcTS
fXcWcWTbPUUa^]_PachCWTX]XbcTa³bR^]cT]cX^]cWPcQTX]VPaT[PcXeT^U
19?[TPSTabbW^d[S]^cQTPWX]SaP]RTU^acWTSTbTaeX]VRP]SXSPcTbXb
VT]dX]TP]SbW^d[SQTPRRT_cPQ[Tc^TeTah^]T1TX]VcWTZXcWP]SZX]^U
cWTad[X]V_Pach[TPSTabXbP]PSSTS`dP[XUXRPcX^]fWXRW]PcdaP[[hcX[cb
bRP[TbX]cWTXaUPe^daX]cWTbT[TRcX^]_a^RTbb
70A0:´B?;0=
AX__[TbfTaTRaTPcTSX]cWT_^[XcXRP[TR^bhbcT^UcWT7XP[PhP]bcPcT
aTRT]c[hfWT]cWT_^fTaUd[RPQX]TcX]XbcTa7PaPZBX]VWAPfPc
_a^R[PXTScWPcWTXb]^^aTX]cTaTbcTSX]R^]cTbcX]VcWTd_R^X]V
PbbTQ[hT[TRcX^]bFWX[Tb^T[X]ZTScWTP]]^d]RTT]cfXcWcWT
VadSVTWTW^[SbU^aQTX]VXV]^aTSX]cWT_Pach^cWTab_^X]c^dccWPc^]T
bW^d[S]^caTPSc^^dRWX]c^cWTP]]^d]RTT]c^UcWTfX[h[TPSTaP]S
cTaTSXc_aTbbdaT_^[XcXRbc^VTc19?³bcXRZTcU^aWXbSPdVWcTaX][PfPb
fT[[7XbSTR[PaPcX^]P[b^TP]bcWPccWTTaRdaXP[[TPSTafW^XbZ]^f]
c^W^__PacXTbP]SRWP]VTWXbbTPcX]TeTahPbbTQ[hT[TRcX^]R^d[SPVPX]
RWP]VTcWTbTPcP]S]^cR^]cTbcUa^:^cSfPaX]cWThTPa!!!fWTaT
cWX]VbPaT]^cb^a^bhU^aWX
20=383=
=C4B
1h6PYT]SaPBX]VW=TVX
?=BQ 347A03D=
Chief Minister Puskhar
Singh Dhami met famous
hockey player Vandana
Katariya at her residence in
Roshanabad in Haridwar on
Thursday and felicitated her
after her return from the Tokyo
Olympics. Congratulating
Katariya on her stupendous
feat, the CM said that she has
enhanced the pride of the state.
He said that by scoring a hat
trick in the Tokyo Olympics,
she has created a distinct iden-
tity for herself. Dhami exhort-
ed her to work hard and con-
tinue playing with the same
zeal and determination. He
said that the state government
is devising a new sports policy
so that better facilities are
made available to the
sportspersons.
On the occasion Dhami
handed her a cheque of Rs 25
lakh. He also felicitated her
with the Tilu Rauteli award
which includes a citation and
reward of Rs 31,000. It is worth
mentioning here that the
Uttarakhand Government has
made Vandana Katariya as the
brand ambassador of Beti
Bachao Beti Padhao scheme.
Cabinet Minister Dhan
Singh Rawat, Yetishwaranand,
MLAs Deshraj Karnwal, Adesh
Chauhan, secretary, women
and child development depart-
ment HC Semwal and relatives
of Vandana Katariya were pre-
sent on the occasion.
45YR^ZWV]ZTZeReVd
Y`TVjdeRcGR_UR_R
?=BQ 347A03D=
The high and recurring cost
of dialysis is a major drain
on the savings of the patients
with kidney patients. In a major
relief to such patients the
Uttarakhand government had
included the dialysis in the
Ayushman Yojana. The chair-
man of the state health agency
(SHA), DK Kotia said that the
patients of the kidney ailments
have so far availed benefit of
1.33 lakh dialysis under the
scheme and an amount of Rs 42
crore has been spent on the dial-
ysis. He said that the Ayushman
Yojana has made things easy for
kidney patients as a costly pro-
cedure like dialysis has come
under the ambit of the scheme.
Kotia said that the Ayushman
Yojana is acting as a life saver for
kidney patients.
It is pertinent to mention
here that a sum of Rs 12,00 to
15,00 is spent every time a
dialysis patient undergoes dial-
ysis. A sum of Rs 18,000 to Rs
20,000 is spent every month on
peritoneal dialysis of patients.
Launched on December 25,
2018, the AAUY provides a
cover of Rs five lakh per annum
to all 23 lakh families of
Uttarakhand in the panelled
hospitals under the scheme.
Patients can avail benefit of the
scheme for 1,350 types of dis-
eases in the panelled hospitals.
A total of 3.11 lakh patients
have so far availed the benefit of
the scheme and a sum of Rs 390
crore has been spent on the
Yojana so far.
ODNKGLDOVLV
GRQHXQGHU
$XVKPDQRMDQD
?=BQ 347A03D=
The State Health depart-
ment reported only 24 new
cases of the novel Coronavirus
(Covid-19) and 37 recoveries
from the disease in
Uttarakhand on Thursday. No
death from the disease was
reported in the state on the
day.
The cumulative count of
Covid-19 patients in the state
is now at 3,42,526 while a total
of 3,28,695 patients have
recovered from the disease so
far. In the state 7369 people
have lost their lives to Covid
-19 till date. The recovery
percentage from the disease is
at 95.96 while the sample pos-
itivity rate on Wednesday was
0.12 per cent.
The State Health depart-
ment reported four new
patients of Covid -19 each
from Pauri, three each from
Bageshwar, Dehradun,
Pithoragarh and Uttarkashi,
two each from Champawat,
Nainital and Rudraprayag and
one each from Chamoli and
Haridwar on Thursday. No
new patient was found in
Tehri and Almora districts on
the day.
The State now has 418
active cases of Covid 19.
Dehradun with 161 cases is at
top of the table of active cases
while Pithoragarh is at second
spot with 57 active cases.
Chamoli has 51, Champawat 23,
Uttarkashi 22, Bageshwar 19,
Haridwar and Pauri 12 each,
Nainital seven, Almora six and
Tehri five active patients each of
the disease.
The state reported one new
case of Mucormycosis (Black
fungus) on Thursday. A total of
571 patients of the disease have
so far been reported. In the
ongoing vaccination drive
1,19,194 people were vaccinat-
ed in 821 sessions in different
parts of the state on Thursday.
?=BQ 347A03D=
The Tatas,
F r e d d i e
Mercury and
Other Bawas: An
Intimate History of
the Parsis by noted
journalist Coomi
Kapoor was
released at the
Natraj Bookshop
here today.
Speaking on
the occasion,
Coomi Kapoor
said that the feud
between Ratan
Tata and Cyrus
Mistry and the role played by
Nusli Wadia, the blue-blooded
chairperson of the Bombay
Dyeing Group inspired her to
write the book in an attempt to
share some unknown facets of
the community with the out-
side world. She added that it
was a fun book and hoped that
all readers would enjoy as
much as she relished writing it.
Senior advocate in the Supreme
Court, Roxna Swamy, presiding
over the book launch told
those present that Dehradun
had only about four members
from the community and was
happy that out of these, two
were present in the audience.
After releasing the book,
senior journalist Suhasini
Haidar told a select audience
that the book is well-
researched, informative and
brings out in vivid colours, the
saga of a microscopic commu-
nity to which the author proud-
ly belongs.
She hoped that the religion
that has survived for so long
despite all odds, will somehow
manage to survive in spite of
the declining number of believ-
ers with the indomitable spir-
it of the community not being
easily snuffed out. She compli-
mented the Parsis for the amaz-
ing and remarkable success
that they had achieved in India
and all over the world.
Natraj Bookshop propri-
etor Upendra Arora recalled his
association with members of
the Parsi community and said
it was an honour for Natraj to
have published the official
biography of Field Marshal
Sam Manekshaw and launch
the book We the Nation by
Nani Palkiwala, both celebrat-
ed Parsis of the nation. He said
he was fortunate that the first
book published by his pub-
lishing house in 1966, on for-
est engineering was written by
Navroz J Masani, a member of
the Parsi community, who was
then posted in the Forest
Research Institute here.
Former senior bureaucrats
Surjit Das, Vinod Kumar and
Kamalesh Sharma along with
noted author and historian
Roshen Dalal and other book
lovers were also present on the
occasion.
?=BQ 347A03D=
Uttarakhand Congress has
demanded that the cabinet
minister Rekha Arya should
resign on moral grounds since
the Uttar Pradesh (UP) police
have issued a non-bailable
warrant (NBW) against her
husband.
The Pradesh Congress
Committee (PCC) president
Ganesh Godiyal told media
persons here on Thursday
that instead of conducting
introspection; Arya is
engaged in a verbal war with
the former Chief Minister
and general secretary of All
India Congress Committee
(AICC) Harish Rawat. He
said that the language used by
the minister is highly
deplorable. Coming down
heavily on the president of
state BJP Madan Kaushik for
defending the husband of
Rekha Arya, Godiyal said
that Kaushik is telling that the
case is 25 years old. He said
that it appears as if the BJP
president considers himself
above the law.
Godiyal said that it is not
for the first time the BJP is
shielding those involved in
criminal activities.
The PCC president said
that the manner in which
the BJP leaders are targeting
Harish Rawat clearly reflects
that the party is afraid of
Rawat who is very popular
among the people.
CWT2TTcb
:PcPaXhPPcWTaW^T
X]7PaXSfPa*WP]Sb
^eTaPRWT`dTU^a
C!$[PZW
2GQWQY^cdXecRQ^T3_^W
cUU[cBU[XQ1biQµcbUcYW^QdY_^
2__[_^XYcd_bi_V@QbcYcRi
3__]Y;Q`__bQe^SXUTY^4__^
?=BQ 347A03D=
Women of self-help groups
protested against the
State government for inviting
tenders of private contractors
for the packaging and supply of
take home ration (THR) which
will snatch the livelihood of
over two lakh women in
Uttarakhand. On Thursday,
hundreds of women protested
outside the office of the
Women Empowerment and
Child Development (WECD)
department located at Nanda
Ki Chowki.
According to the president
of Nari Shakti Swaroop Mahila
Pradesh Sangathan (NSSMPS),
Geeta Maurya, the women of
SHGs are working for THR
packaging and supply for the
last eight years under the
National Rural Livelihood
Mission (NRLM) but now the
government has invited e-ten-
ders for this work from private
contractors. “The government
here talks about vocal for local
campaign, women empower-
ment and development of
underprivileged and rural
women but the same govern-
ment is ready to make lakhs of
women unemployed by allo-
cating Rs 560 crore to privatise
this work through big compa-
nies,” said Maurya. Maurya
said that she and Shyama Devi
were recently felicitated with
the Tilu Rauteli award by the
chief minister Pushkar Singh
Dhami for their work in THR
and now he is snatching that
work.
“We even met him to
return this award recently as it
does not mean anything if we
cannot continue our work. The
CM said he will consider our
appeal against inviting the e-
tender and gaver our awards
back to us but he obviously did
not keep his word,” stated
Maurya. One of the protestors,
Pooja Dwivedi said that most
of the women associated with
THR works are underprivi-
leged, widows and some moth-
ers who work to feed their dis-
abled children and the gov-
ernment is snatching their
livelihood. She said, “We have
approached the state govern-
ment politely many times to
cancel this e-tender but we will
be forced to intensify our
protest if the government fails
to do so soon.” The women
protestors said the officials are
telling the SHGs that the ration
provided to kids in THR is not
nutritious enough. “The gov-
ernment officials decide what
should be in the menu of THR
and we provide the same to the
Anganwadi centres so blaming
us is illogical.
We have been informed
that the government will now
provide THR in powdered
form like a protein shake pow-
der which is certainly not
healthier than the food pro-
vided by the SHGs under the
department,” said Dwivedi.
The protestors said they will
march towards the Secretariat
on Friday and threatened that
they will not let this govern-
ment win in 2022 assembly
elections if they lose their
livelihood.
6+*VDFFXVH6WDWH*RYW
RIVQDWFKLQJOLYHOLKRRG
RIODNKZRPHQ
?=BQ 70A83F0A
The Municipal Corporation
of Haridwar (MCH) will
focus on making Haridwar an
ideal city of the State and no
unauthorised political pres-
sure will be accepted on the
functioning of the corpora-
tion. The newly appointed
municipal commissioner
Dayanand Saraswati stated
this while talking about his
work priorities in the corpo-
ration.
He said that the corpora-
tion will also make a plan for
the proper collection and dis-
posal of garbage generated in
the city.
According to him, the
corporation will also work
on the waterlogging and san-
itation issues in the city.
He said that the MCH will
conduct awareness campaigns
to encourage locals to dispose
of segregated domestic waste
which will make the garbage
disposal process easy for the
MCH.
Saraswati, who has also
served as the deputy Kumbh
Mela officer asserted that the
corporation will work hard at
every level to make Haridwar
an ideal city and no irregu-
larities will be tolerated. He
also revealed that he will soon
demand more sanitation
employees from the State
administration as the corpo-
ration does not have ade-
quate workers to carry out the
work. The new commission-
er also made it clear that he
will not allow any unautho-
rised political pressure to
affect the working methods of
the corporation and every
work will be done considering
the welfare of the public.
D]PdcW^aXbTS
_^[XcXRP[_aTbbdaT
]^cPRRT_cPQ[TX]
27)BPaPbfPcX
?=BQ 347A03D=
At the times when proper
garbage disposal remains a
big concern for all urban local
bodies (ULBs), the
Rudraprayag municipality has
set an example of effectively
tackling the garbage disposal
issue in Uttarakhand. For the
past three years, Rudraprayag
municipality is not just work-
ing for proper garbage dis-
posal but also towards making
it a revenue source for the
municipality.
According to the executive
officer (EO) of Rudraprayag
municipality, Seema Rawat,
the civic body started selling
the non-biodegradable
garbage collected through
door to door collection from
the year 2019. “We earned rev-
enue of Rs 19,000 in the year
2019 and Rs 87,000 in 2020.
This year, we have already
earned about Rs five lakh by
selling the non-biodegradable
waste collected from across the
city and this will go over Rs 10
lakh by the end of the year,”
stated the EO. She revealed
that Rudraprayag municipali-
ty had to work hard to reach
at the level where they can sell
maximum inorganic waste.
“We conducted various cam-
paigns to raise awareness
among locals to keep their dry
and wet garbage separately
and distributed two dustbins
to every household in the city
for the same purpose. Even the
sanitation workers were
ordered to not accept the
mixed dry and wet garbage
that they still follow,” said
Rawat. She also disclosed that
all the dumpsters have been
removed from the city and
everybody is asked to dispose
of their garbage through the
door to door collection. “We
constantly encouraged people
to dispose of their garbage
through door to door service
and penalised those who were
found to be disposing of the
garbage in open areas.
This is the reason that all
the garbage collected by the
sanitation workers is now seg-
regated at source which makes
it easier for us to sell the non-
biodegradable waste,” said
Rawat.
She informed that the
municipality sells seven to
eight metric tonnes of inor-
ganic waste to a company in
Rishikesh every month that
generates the revenue of about
Rs 80,000 per month which is
used in the development pro-
jects of the city. She said
biodegradable waste is used to
make compost which will be
sold soon commercially too.
FPcTa^eTaU[^fbUa^cWTRWPQTa^UPSaPX]X]cWTXSS[T^UcWTAXb_P]PaXeTaQTSX]3TWaPSd] ?X^]TTa_W^c^
RYLG2QOQHZ
FDVHVUHSRUWHGLQ8¶NKDQG
BeTbQ`bQiQW
]e^YSY`QYdiWU^UbQdUc
bUfU^eUVb_]WQbRQWU

4. ]PcX^]#
347A03D=k5A830H k0D6DBC !!
?=BQ =4F34;78
As the fighting intensified in
Afghanistan with the
Taliban making rapid advances,
India on Thursday said the sit-
uation there is of “concern” and
it continues to hope for a com-
prehensive ceasefire. This
observation came days after
India advised its citizens in
Afghanistan to leave the coun-
try.
Giving a sense of the situ-
ation in Afghanistan, Ministry
of External Affairs (MEA)
Spokesperson Arindam Bagchi
also said here India is in touch
with all the stakeholders in
Afghanistan and closely mon-
itoring the ground situation in
the war-ravaged country.
Bagchi said India attended
a regional conference on
Afghanistan in Doha on
Thursday at the invitation of
Qatar. “The situation in
Afghanistan is of concern. It is
a rapidly evolving situation. We
continue to hope that there will
be a comprehensive ceasefire in
Afghanistan,” he said.
Asked about Pakistan’s
continued support to the
Taliban, Bagchi said the inter-
national community is well
aware of that country’s role.
The Taliban has been making
rapid advances across
Afghanistan by resorting to
widespread violence since the
United States began with-
drawing its troops from the
country on May 1.
India is engaged with a
number of stakeholders and
leading powers on the latest
developments in Afghanistan. It
is supporting a national peace
and reconciliation process that
is Afghan-led, Afghan-owned
and Afghan-controlled.
India has also called upon
all sections of the political
spectrum in Afghanistan to
work together to meet the aspi-
rations of all people in the
country, including those from
the minority communities, for
a prosperous and safe future.
Bagchi also said the Indian
consulate in Mazar-e-Sharif
has withdrawn all India based
personnel earlier this week.
However, it is a temporary
measure, he said.
The spokesperson also clar-
ified there is no formal evacu-
ation mechanism and all Indian
nationals there were advised to
leave Afghanistan through
commercial means.
He said last year the Indian
embassy in Kabul had facilitat-
ed the return of over 383
Hindus and Sikhs from there.
The embassy is in touch with
both the communities there
and will ensure provision of all
necessary assistance to them, he
pointed out.
DZefReZ`_Z_2WZd`WT`_TVc_+:_UZR
A0:4B7:B8=67Q
=4F34;78
In what could further com-
plicate the security of Indian
assets in Kabul already under
threat of a ramaging Taliban,
Pakistani covert agency Inter-
Services Intelligence (ISI) has
floated a new terror outfit
styled as Hizb-e-Wilayat to
carry out attacks exclusively on
Indian assets in Afghanistan.
The outfit, headed by one
Dr Anwar Firdausi, will com-
prise elements of the 10,000
jehadis pushed across the bor-
der by Pakistan into
Afghanistan to aid the Taliban
in violent takeover of the war-
ravaged country from the
democratically elected Abdul
Ghani Government, sources
privy to the development said.
The ISI move coincides
with the takeover of six
Afghan provinces by the
Taliban in quick succession.
Besides sending the
jehadis to Afghanistan, the ISI
has also forged an alliance
between its terror cohorts
Lashkar-e-Tayabba and Jaish-
e-Mohammad with the
Taliban for the continuing
onslaught in that country to
target Indian assets.
During the last two
decades, India has invested
USD 3 billion in reconstruc-
tion efforts in Afghanistan
after the Taliban was dis-
lodged by the US-led forces in
2001.
The Taliban has already
shot down one helicopter and
captured another such
machine. The helicopters were
gifted by India to the
Afghanistan government.
Besides the nexus between
the Taliban and Pakistan
Army-ISI, Islamabad’s all-
weather ally Beijing has also
reportedly joined forces with
the UN-sanctioned terror
group for supply of surface-to-
air (SAM) missiles to challenge
bombings by American B-52
bombers.
In addition to the latest
move of launching a terror
outfit to exclusively and selec-
tively target Indian invest-
ments in Afghanistan, the ISI
is feeding misinformation to
maximize attacks against
Indians and their assets in that
country.
The ISI manoeuvres have
posed threat to the Indian
embassy in Afghanistan as
well as those in the entire
region, the sources said.
TheISIhasreportedlycon-
vinced the Taliban that India
hadrecentlybombedagroupof
Taliban in Kandahar province
of Afghanistan. The Pakistani
agency has further told the
Taliban that attack helicopters
and military planes that were
built in India were handed
over to Afghan defence depart-
ment some time ago. The ISI
has further been able to con-
vince the Taliban that fighter
jets were stationed in Kabul air-
port under Indian command
with Indian pilots.
“TheISI’smovesarepartof
its bid to cement its leverage
with the Taliban to have a sig-
nificant say in managing the
war-ravaged country to stay
geopolitically relevant and
diminish India’s role in recon-
struction efforts there.
Simultaneously, Pakistan is also
seeking to draw China in its
game to supplant the Taliban at
the helm of affairs in that coun-
try post completion of with-
drawal of US troops early next
month,” a security expert said.
8B8U[^Pcb]TfcTaa^a^dcUXc7XiQc^
WXc8]SXP]PbbTcbf^acWDB3Q]
?=BQ =4F34;7
Defence Minister Rajnath
Singh on Friday will for-
mally launch various events
virtually from here to mark the
75th anniversary of India’s
Independence. The armed
forces and different organisa-
tions of the Defence Ministry
are conducting various events
across the nation to commem-
orate the anniversary.
Giving details of Rajnath’s
event, officials said here on
Thursday, the Border Roads
Organisation (BRO) will unfurl
the National Flag at 75 impor-
tant mountain Passes and
Places in the country.
They said 75 teams of the
BRO will depart on Friday to
these remote passes. The most
prominent among them is
‘Umlingla Pass’, which is the
Highest Motorable Road in
the World at 19,300 feet, in
Eastern Ladakh. The national
tri-colour will also be unfurled
at prominent infrastructure
landmarks like Atal Tunnel,
Rohtang and Dhola Sadiya
Bridge in the Northeast, besides
in friendly foreign countries.
The Indian Coast Guard
will unfurl the National Flag at
100 islands Pan-India on
August 15 as part of ‘Azadi ka
Amrit Mahotsav’.
The Indian Navy personnel
and their families will partici-
pate in the freedom run at
Naval Officers Mess Varuna,
New Delhi. The Raksha Mantri
will virtually flag off the free-
dom run, which is part of the
Fit India Freedom Run 2.0
being launched across the
country on Friday.
To instill a sense of pride
and confidence among citi-
zens that the Indian Army is
committed to protecting the
country in all types of terrain
and climate, the teams of the
Army will scale 75 mountain
passes to mark this momen-
tous occasion.
The passes include Saserla
Pass in Ladakh region,
Stakpochan Pass in Kargil
region, Satopanth, Harshil,
Uttarakhand, Phim Karnla,
Sikkim and Point 4493,
Tawang region of Arunachal
Pradesh. Rajnath will flag off
the event on Friday.
To pay homage to the
freedom fighters and the
brave-hearts of the country for
their invaluable role in India’s
Independence, National Cadet
Corps (NCC) will conduct a
Pan-India event, ‘Swatantra
Senaniyon ko Naman’. The
NCC cadets will carry out
cleaning and maintenance of
825 statues adopted by 825
NCC Battalions.
In another endeavour to
honour the Gallantry award
winners and motivate people,
especially the youth, to inter-
act with the Gallantry awards
portal a ‘Gallantrypedia of
Awardees’ will be launched.
Also, to commemorate
India’s victory in the 1971 war,
a book ‘Deeds of Gallantry’
will be launched by the
defence minister. The book
details 20 selected battles and
highlights the gallantry of
Indian soldiers.
In another initiative aimed
at addressing the issues of the
veterans, Jan Sampark
Abhiyan will be launched
wherein a representative each
of the respective Zila Sainik
Board along with a represen-
tative of Indian Ex-
Servicemen League, a recog-
nised ex-servicemen(ESM)
association, will interact
simultaneously with the ESM
fraternity in 75 districts across
the country. The objective is
to address the issues of the
veterans in a time-bound
manner.
APY]PcW[Pd]RWTbTeT]cbc^SPh
c^PaZ8]SXP³b$cW83Ph
?=BQ =4F34;7
In an effort to further
strengthen its ties with the
Gulf countries, India and Saudi
Arabia are now engaged in the
first ever joint naval exercise
there.
The drill including shore-
based and sea exercises comes
in the backdrop of Army Chief
General M M Naravane visit to
that country last year followed
by IAF Chief R K S Bhadauria’s
tour of the UAE recently.
Naravane’s visit to Saudi Arabia
was the first ever by an Indian
army chief.
Giving details of the naval
exercise, a navy official said
here on Thursday the Indian
Navy’s visit to the Kingdom of
Saudi Arabia was set rolling
with the Flag Officer
Commanding Western Fleet
(FOCWF), Rear Admiral Ajay
Kochhar, visiting the Fleet
Commander of Royal Saudi
Navy’s Eastern Fleet, Rear
Admiral Majid Al Qahtani,
on Wednesday.
This was held at King
Abdul Aziz Naval Base, which
is the Headquarters for Saudi
Eastern Fleet. The Indian offi-
cer also visited the King Fahd
Naval Academy and met with
the Commandant Rear
Admiral Faisal Bin Fahd Al
Ghufaily.
The Indian ambassador to
Saudi Arabia Ausaf Sayeed
visited INS Kochi at Al Jubail
and held a press conference
onboard along with the
FOCWF and the
Commanding Officer of the
ship.
On Thursday, the Indian
Western Fleet Commander
accompanied by the Indian
Ambassador called on the
Governor of Eastern Province
of Kingdom of Saudi Arabia,
Saud bin Nayef Al Saud at
Dammam.
On the operational front,
gearing up for the maiden
bilateral exercise ‘AL – Mohed
AL – Hindi’, the team of Indian
Navy met with counterparts of
the Royal Saudi Navy for a co-
ordinating conference at King
Abdulaziz Naval base in Al
Jubail, Saudi Arabia. For deep-
er understanding of each
other’s operational practices,
lectures by subject matter
experts from both navies were
also held.
Incidentally, INS Kochi
last week had held joint exer-
cise with the UAE navy off the
coast of Abu Dhabi. The UAE
is the first country in the Gulf
to establish diplomatic ties
with Israel.
The IAF had taken part in
a multi-nation air exercise
with the UAE in March this
year there. The US, Saudi
Arabia, France, South Korea,
UAE and Bahrain were the
other participants.
Signifying the growing ties
with the countries in the Gulf,
India is holding parleys with
the UAE and Saudi Arabia for
exporting its indigenously
manufactured supersonic mis-
sile Brahmos and Akash sur-
face to air missile.
8]SXPBPdSX0aPQXPPXST]
]PeP[SaX[[c^P_d_STUcXTb
?=BQ =4F34;7
Former Congress president
Rahul Gandhi on Thursday
attacked Prime Minister
Narendra Modi, claiming he
will be “thrown” out of power
by a “storm” created by the
voices of poor, Dalits, farmers
and workers in the country.
Leading a Halla Bol protest by
party workers, Rahul said that
the people of the country
understood the current situa-
tion in the country and the
Congress and its frontal organ-
isations have a job to remind
them that they need not fear
any force but challenge it.
“A voice of poor, Dalits,
farmers and workers will be
heard in the country. It will
gather momentum gradually
and turn into a storm that will
throw Narendra Modi out of
Prime Minister’s residence,”
Rahul Gandhi said addressing
partymen at the protest at
Jantar Mantar. The SC/ST
department of the Congress
organised the protest against
alleged atrocities on Dalits.
The protest was also
attended by many senior
Congress leaders including P
Chidambaram, KC
Venugopal, Nitin Raut,
Sushmita Dev and Delhi unit
president Anil Kumar.
“Our job is to remind
people of India what Baba
Saheb and Mahatma Gandhi
said. They said - do not be
afraid of anyone. These cow-
ards and hollow people will
run away, the day country
starts fighting them. It’s job of
Congress, SC/ST department,
Youth Congress and NSUI to
remind people of India that
they can challenge any force
without fearing it,” Rahul
Gandhi said.
He claimed that the
Constitution is under attack
from all sides in the country.
“We are not allowed to speak
in Parliament if we raise the
issues of farmers, Dalits, back-
ward classes and women,” he
alleged.
“For the first time in the
history of the country, parlia-
mentarians were beaten and
shoved in the Rajya Sabha,” he
alleged further.
E^XRTb^U_^^a3P[Xcb
UPaTabc^STcWa^]T
^SXbPhbAPWd[
0A270=09HC8Q =4F34;78
Usually elephants perceive
humans as a threat and
retreat away from them appar-
ently as a risk-avoidance strat-
egy, a study has said thus indi-
cating that the jumbos come
into conflict with people only
when they perhaps have no
choice.
The study holds impor-
tance at a time when there have
been increased incidents of
human-pachyderm conflicts
across the wildlife habitat, and
can be a useful strategy for ele-
phant conservation.
Previous studies have
found they avoid the acoustic
sounds of bees, tiger growls,
human voices, and other ele-
phants’ alarm calls. But
whether they could also iden-
tify and discriminate between
different ground-based sounds
was unclear. To find this
researchers at the University of
Oxford and an NGO ‘Save the
Elephants’ played seismic
recordings of elephants and
human-generated white noise,
as well as a combination of
both, to wild elephants in
Samburu National Reserve and
Buffalo Springs National
Reserve in northern Kenya.
When the researchers led
by Dr. Beth Mortimer, a zool-
ogist at the University of
Oxford, her colleagues and a
team from Save the Elephants
played human-generated noise
(alone or in combination with
elephant sounds), the wild ele-
phants often froze and
appeared to listen vigilantly to
the strange sounds. They also
moved farther away from the
sources of human-generated
noise than they did from ele-
phant-generated noise, sug-
gesting they associated the
human noises with risk.
Dr. Beth Mortimer said:
“Human-generated seismic
noise is something the ele-
phants were retreating from.
That leads us to the conclusion
that they’re associating it with
risk. We don’t know why—there
could be many reasons that
they’re choosing to retreat.”
“It was a surprising out-
come, but very important in
terms of showing that they get
information from human-gen-
erated vibrations. It’s not just
elephant-generated seismic
vibrations that are relevant to
them.’
Even in the relative tran-
quility and removal of protect-
ed areas such as the National
Reserves, the ground carries
human-generated noise from
vehicles, generators, gunfire,
and other sources, which
according to the new study’s
findings could be enough to
disrupt elephants’ behaviour.
Chris Thouless, Save the
Elephant’s Head of Research
said, “We still know very little
about how elephants use infra-
sound to communicate with
each other and to appreciate
their environment. They oper-
ate in a sensory world that is
very different from our own,
‘hearing’ low frequency noises
through their feet. They may
detect other elephants, distant
thunderstorms, and noises of
human activities at great dis-
tances.
9dQ^bbW^faXbZPe^XSP]RTQTWPeX^da
c^WdP]VT]TaPcTS]^XbTbPhbbcdSh
?=BQ =4F34;78
Prime Minister on Thursday
lauded women self-help
groups for their “unprecedent-
ed services” during the pan-
demic period in making masks,
sanitisers and providing food to
needy and spreading awareness
and asserted that the amount of
help his Government provided
under the National Livelihood
Mission is “many times more
than the previous Government”.
Modi said that the SHGs
and Deendayal Antyodaya
Yojana have brought a “new
revolution in rural India.” He
added this movement of
women SHGs has intensified in
the last 6-7 years and today
there are 70 lakh SHGs across
the country which is more
than three times the figure
during 6-7 years, he said.
Participating in
‘Atmanirbhar Narishakti se
Samvad’ , the Prime Minister
interacted with women SHG
members/community resource
persons promoted under the
Deendayal Antyodaya Yojana-
National Rural Livelihoods
Mission (DAY-NRLM) via
video conferencing.
During the event, a com-
pendium of success stories of
women SHG members from all
across the country, along with
a handbook on universalisation
of farm livelihoods was released
by the Prime Minister.
He also released capitaliza-
tion support funds to the tune
of C1,625 Crore to over 4 lakh
SHGs. In addition, he released
C25 crore as seed money for
7,500 SHG members under the
PMFME (PM Formalisation
of Micro Food Processing
Enterprises) Scheme of
Ministry of Food Processing
Industries and Rs. 4.13 crore as
funds to 75 FPOs (Farmer
Producer Organizations) being
promoted under the Mission.
Union Minister for Rural
Development and Panchayati
Raj, Giriraj Singh; Union
Minister for Food Processing
Industries Pashupati Kumar
Paras; Ministers of State-Rural
Development, Sadhvi Niranjan
Jyoti and Faggan Singh Kulaste;
Minister of state – Panchayati
Raj, Kapil Moreshwar Patil and
Minister of state – Ministry of
Food Processing Industry,
Prahlad Singh Patel, were also
present on the occasion.
The PM said that to
increase the scope of entrepre-
neurship among women and
for greater participation in the
resolve of AatmaNirbhar
Bharat, a major financial sup-
port has been given today to
more than 4 lakh SHGs on the
eve of Raksha Bandhan.
He recalled the time before
this government when crores of
the “sisters” did not have a bank
account, they were miles away
from the banking system. That
is why the government started
the massive campaign to open
Jan Dhan accounts, he said.
He said today there are
more than 42 crore Jan Dhan
accounts of which close to 55%
of the accounts are of women.
^SX[PdSbf^T]B76bU^a
bTaeXRTbSdaX]V_P]STXR
?=BQ =4F34;78
Between June 26 and July 25,
Twitter has suspended
31,637 accounts in India. The
micro blogging platform
received 120 grievances and
‘actioned’ 167 URLs during
this period. In its monthly
compliance report as mandat-
ed by the new IT rules, Twitter
India said the majority of com-
plaints received via Grievance
Officer channel during the
reporting period fell into cate-
gories like Abuse/ Harassment
(36), Misinformation/ Synthetic
and Manipulated Media (28),
Defamation and IP-related
Infringement (13 each), Hateful
Conduct (12), Impersonation
(8), Sensitive Adult Content (5),
Privacy Infringement (4) and
Terrorism/ Violent Extremism
(1).
The highest number of
URLs actioned pertained to
Abuse/ Harassment and IP-
related Infringement (46 each),
followed by Privacy
Infringement (35),
Impersonation (16) and
Defamation (15). URLs
actioned under
Misinformation/ Synthetic and
Manipulated Media category
stood at seven, and Sensitive
Adult Content and Hateful
Conduct (one each).
The social media giant said
that Twitter does not tolerate
any material that features or
promotes child sexual exploita-
tion — whether in Direct
Messages or elsewhere through-
out the service.
?=BQ =4F34;78
The Centre on Thursday
said that while Covid-19
cases were “stabilising” across
the country, the R value greater
than 1, specifically from newer
states, including Punjab,
Himachal Pradesh and Uttar
Pradesh, is a “significant reason
to be concerned”. In Punjab, the
daily cases are increasing.
In fact, the Covid-19 tally
of India rose to 3,20,77,706
after 41,195 people were found
to have tested positive in the
last 24 hours on Thursday.
The number was a significant
rise from a day ago at 38,353
cases. The daily death toll also
saw a rise as 490 people suc-
cumbed to Covid-19, data
released by the Union Health
Ministry showed.
Kerala continues to be the
top contributor recording
23,500 cases, followed by
Maharashtra which saw 5,560
people testing positive.
The death toll has now
reached 4,29,669. Whereas, the
number of active cases has
dipped to 3,87,987 and now
consists only 1.21% per cent of
the total caseload. As many as
3,12,60,050 people have recov-
ered from the disease as of
Thursday.
India’s Covid-19 vaccina-
tion coverage has crossed the
landmark of 52 Crore.
Cumulatively, 52,36,71,019 vac-
cine doses have been adminis-
tered through 59,97,068 ses-
sions, as per the provisional
report till 7 am on Thursday.
44,19,627 vaccine doses were
administered in the last 24
hours, said the Ministry.
FWX[T2^eXSRPbTb
bcPQX[XbX]VAeP[dT
VaTPcTacWP] )6^ec
?=BQ =4F34;78
Union Health Minister
Mansukh Mandaviya on
Thursday met World Health
Organization (WHO) chief
scientist Dr Soumya
Swaminathan and held a dis-
cussion over the global health
body’s global authorisation of
Bharat Biotech’s Covaxin.
Hyderabad-based Bharat
Biotech had in May this year
submitted an application to
the WHO for Emergency Use
Listing (EUL).
7TP[cWX]
TTcb
F7RWXTU
CfXccTaUaTTiTb %
PRR^d]cbX]8]SXP
80=BQ =4F34;78
The Supreme Court has
held that the fundamental
right to shelter cannot be
construed as a right to gov-
ernment accommodation for
retired government employ-
ees.
A bench of Justices
Hemant Gupta and A.S.
Bopanna noted the right to
shelter is a fundamental right,
that may not be disputed, but
such a right of shelter is
granted to millions of Indians
who do not have shelter.
A section of society, more
so retired government
employees, who had earned
pension, drawn retirement
benefits, cannot be said to be
in such condition.
AXVWcc^bWT[cTaS^Tb]³c
TP]6^ecW^dbX]VU^a
d][XXcTS_TaX^S)B2

5. ]PcX^]$
347A03D=k5A830H k0D6DBC !!
?=BQ ;D2:=F
Amid continuous downpour,
the Uttar Pradesh
Government has expedited its
relief and rescue operations on
a war footing to prevent any loss
of life and damage to property
in the flood-affected areas of the
State.
The Government has been
making elaborate arrangements
toproviderelieftopeopleaffect-
ed by the floods. The work of
shifting people in the flood
affected areas to other places as
well as providing dry ration is
being done at a rapid pace. As
many as 951 flood shelters com-
plying with Covid protocol have
been set up for the people
trapped in the flood affected
areas of the State. In the flood
relief camps, facilities like drink-
ing water, toilets, clothes, uten-
sils and beddings among others
are being provided.
On the instruction of Chief
Minister Yogi Adityanath, as
many as 70,050 lunch packets
and over 9,506 dry ration pack-
ets have been distributed by the
government to the flood affect-
ed people in the last 24 hours.
Due to heavy rain, as many
as 1,243 villages of over 23 dis-
tricts of the State have been
affected by the floods. At the
same time, the water levels of
rivers Ganga, Yamuna, Betwa,
Sharda, Kuwano and Chambal
have risen above the danger
level. Teams of NDRF, SDRF
along with PAC have been
deployed for relief and rescue
work in these districts. The
command of the relief and res-
cueoperationshasbeengivento
PAC in 39 districts, while SDRF
hasbeendeployedin11districts
and NDRF in nine districts.
The state government has
deployed as many as 1,992 boats
for rescue operations in the
flood affected areas while 1,228
flood posts have been set up in
the state. As many as 564 med-
ical teams have been constitut-
edintheflood-hitareasandthey
are providing immediate med-
ical treatment to the people
trapped in the floods.
The Jal Shakti Minister has
been directed to review the
floodsituationandreliefandres-
cueworkwiththeofficialsofthe
local administration. An aerial
survey of the flood-hit areas
around the Chambal and
Yamuna districts is being con-
ducted.
C=A067D=0C70 Q D108
Two days after the
Brihanmumbai Municipal
Corporation (BMC) initiated
an offfline Covid-19 vaccina-
tion certificate verification
process and the railway pass
distribution process, the
Maharashtra Government on
Thursday launched an online
facility to enable the fully vac-
cinated citizens to obtain an e-
pass for travelling in suburban
trains in Mumbai.
As part of the exercise, the
state relief and rehabilitation
department introduced already
in-use web link
https://epassmsdma.mahait.org
for purchase of suburban train
e-passes by the common citi-
zens who have not only been
fully vaccinated but have also
completed 14 days after their
second dose.
“The e-pass should be
saved in mobile and after show-
ing the e-pass at the ticket win-
dow at suburban railway sta-
tions, the citizens will get a
monthly travel pass directly
from the Railways. Therefore,
offline verification will not be
required at railway stations, if
universal online e-pass is
obtained,” an official
announcement said.
“Eligible citizens who apply
for the pass will be automati-
cally verified for completion of
Covid-19 Vaccination (14 days
after taking the second dose)
through this web-link. No sep-
arate human interaction will be
required for this online verifi-
cation process. Citizens who
apply without completion of 14
days after second dose of vac-
cine, will receive e-pass only
after completion of that peri-
od,” the announcement added.
The introduction of offline
Covid-19 vaccination certifi-
cate verification process at sub-
urban railway stations along
with the online e-pass system
will make it possible for all eli-
gible citizens to travel in sub-
urban trains from August 15.
Meanwhile, The BMC
appealed to all Mumbaikars not
to crowd at railway stations and
complete the verification
process by either approaching
railway stations in a step-by-
step manner or using the online
process.
Considered one of the
busiest commuter rail systems
in the world, the Mumbai sub-
urban railway system caters to
75 lakh commuters on the
Western Railway, Central
Railway (main) and harbour
railway networks. It is spread
over 390 kilometers.
On August 10, the
Maharashtra Government
announced that the fully vac-
cinated people could travel by
suburban local trains in
Mumbai from August 15.
It may be recalled that the
Central and Western Railways,
which had suspended all their
suburban train services in the
third week of March last year
following the announcement of
*lockdown, resumed opera-
tions for those working in
essential services from June 15
last year.. The services were
gradually increased for the
convenience of passengers and
to avoid crowding and to main-
tain social distancing. From
October 17, it allowed all ladies
to travel by suburban trains for
a specified number of hours
during a day in Mumbai and
Mumbai Metropolitan Region
(MMR).
From November 2
onwards, the Central and
Western Railways increased
the number of services by
another 753 and together
operated 2,773 suburban train
services.
0XPEDLORFDOWUDLQV(SDVVIDFLOLWODXQFKHG
=Tf3T[WX)=PcX^]P[2^^_TaPcXeT
D]X^]^U8]SXP=2D8WPbcPZT]P
]^eT[X]XcXPcXeTU^abd__^acX]V
f^T][TSP]S[TbbTaZ]^f]
R^^_TaPcXeTbf^aZX]VX]aT^cT
_Pacb^U8]SXPQhSTeT[^_X]VP]
TgWXQXcX^]RdbP[TRT]caT]PTS
²=2D87PPc³X]Xcb_aTXbTbCWT
2^eXSS (_P]STXRWPbPSeTabT[h
X_PRcTSPbTRcX^]^UbP[[Ta
T]cTa_aXbTbP]SR^^_TaPcXeTbP]S
cWThPaTbcadVV[X]Vc^ad]cWTXa
QdbX]Tbb
°C^WT[_bdRWT]cTa_aXbTbR^_Td_
fXcWcWTSXUUXRd[ccXTbcWT=2D8
7PPcX]XcXPcXeTWPbQTT]R^]RTXeTS
c^PbbXbcf^T][TSP]S[TbbTa
Z]^f]R^^_TaPcXeTbQh_a^eXSX]V
cWTPbcP[[b_PRTU^acWTXa
_a^SdRcbPcP_aTXd[^RPcX^]X]
3T[WXUaTT^UR^bcP]SWT[_X]VcWT
X]QaP]SX]VP]S_PRZPVX]Vc^^±
3aBdSWXaPWPYP]2WXTU
4gTRdcXeT=2D8bPXS ?=B
?Pc]P)1XWPaQPbTS=60;TTa
5^d]SPcX^]WPbR^]SdRcTSPbTaXTb
^Ub^RXP[fT[UPaTPRcXeXcXTbU^acWT
S^f]ca^SST]X]bTeTaP[bP[[
_^RZTcbX]?Pc]PP]SPSY^X]X]V
PaTPb^]XcbUXabcP]]XeTabPahCWT
U^d]SPcX^]P[b^R^]SdRcTS2^eXS
ePRRX]PcX^]PfPaT]Tbb_a^VaPT
P]SP[b^RP_bc^ePRRX]PcTcWT
[^RP[b5^d]SPcX^]TQTaCPdbXU
0ZWcPabPXScWTePRRX]PcX^]
_a^VaPfX[[V^^]d]cX[cWTT]cXaT
SXbcaXRc^U1XWPabWPaXUP]SXcb
PSY^X]X]VSXbcaXRcbPaTR^eXS
ePRRX]PcTSP]SP__aTRXPcTScWT
WT[_TgcT]STSQhcWTV^eTa]T]c
P]SPSX]XbcaPcX^] ?=B
B0D60AB4=6D?C0Q :;:0C0
Bengal Chief Minister Mamata
Banerjee has once again targeted the
BJP Government for politicizing a “tra-
ditionally neutral and honorable”
autonomous institution like the Union
Public Service Commission days after
candidates appearing for CAPF officers’
examination were asked politically
loaded questions like their opinion on
electoral violence in Bengal and an
allegedly violent farmers’ movement in
north India.
“Though I respect UPSC and have
great regard for its traditional neutral-
ity I cannot help saying that the ques-
tions asked” in a recent examination was
“completely politically motivated …
they were asking aspirants’ opinion on
Bengal electoral violence, on whether
farmers’ agitation was violent and the
inadequate oxygen supply in Delhi …
I am sure these were BJP’s questions …
given by the BJP” in order to assess the
aspirants political leanings, Banerjee
said.
After Election Commission and
National Human Rights Commission
now they have targeted the Union
Public Service Commission which
appointed the country’s top bureaucrats,
Banerjee said adding “the BJP is
destroying the neutral institutions like
UPSC and NHRC.
Banerjee made the comments while
announcing relaxations on pandemic
restrictions in Bengal.
Apparently referring to the damn-
ing report placed by the NHRC in
Calcutta High Court holding the
Trinamool Congress and its
Government responsible for the post-
electoral violence in Bengal Banerjee
said “like NHRC which has become a
tool in the hands of the BJP,” the
Centre was trying to control all the
autonomous institutions.
“Who are the members of the
NHRC … follow their past social
media handle and you will understand
… one of them is a former ABVP front-
line leader … I think he has merely gone
by the BJP version and contributed his
part to the report,” Banerjee said.
In its report on post-poll violence
the NHRC had claimed put up a list of
“notorious criminals” and included the
names of some of party’s senior leaders
including a Minister.
“I am shocked to see such questions
appearing in the UPSC papers …
tomorrow they may post a photo of a
person (read Prime Minister Narendra
Modi) that is appearing everywhere ask-
ing ‘who is the only citizen of India …
you can see his photograph in vaccine
certificates … you can see his presence
from earth to sky to space everywhere
… why should someone have to carry
a the photograph of a person or a party
whom he or she does not like?” Banerjee
said.
“This examination is just one part
of the larger plan to politicize the entire
machinery … you go to the Kolkata
Airport and you will often fine central
force personnel asking you questions as
to whether you are a Modi man or a
Didi man,” she said.
Subsequently speaking to the media
at the SSKM Hospital where three
Trinamool Congress youth wing lead-
ers were undergoing treatment after
they were attacked by alleged BJP men
in Tripura where they had gone to
attend party programmes, the Chief
Minister said “the BJP Government is
suppressing the opposition in that State
and neither the opposition nor the
media have any scope to express their
voices … the journalists who dare to
speak are raided or victimised in some
other manner … is it a government run-
ning.”
Meanwhile the Chief Minister on
Thursday declared extended pandem-
ic restrictions till August 31 but with
some more relaxations. While the edu-
cational institutions will remain closed
the night curfew were reduced by two
hours.
“In place of 9 pm to 5 am it will now
be 11 pm to 5 am,” she said adding local
trains would run only after 50 percent
villages have been vaccinated. “Local
trains will run only after 50 percent of
village population mainly in the districts
of Nadia, North and South 24 Parganas,
Hooghly, Howrah, Burdwan and two
Midnapores have from where people
come to Kolkata every day been vacci-
nated,” she said adding “If we get vac-
cines, we can at least ensure one dose
of vaccine for the rural population and
then we can allow local trains.”
?=BQ :;:0C0
Bengal Opposition Leader
Suvendu Adhikari on
Thursday launched fresh attack
on the Mamata Banerjee
Government for “ruining the
State’s economy” which he said
was running on doles.
Attacking the Chief
Minster for distributing doles
to the people in the name of
Laxmi Bhandar (scheme) that
entails “giving women cash of
a few hundred of rupees”
Adhikari said “even in that
count she has left out the
majority of the people where-
as the TMC manifesto says that
they will cover 5 crore people
in this scheme.”
He said such schemes
would cost the State exchequer
a yearly C15,000 crore at a time
when there was no new source
of taxes for the State.
Attacking the Chief
Minister for driving away
industries Adhikari said “today
industrial investment in Bengal
is nil, there is no land policy, in
last 10 years they have not been
able to successfully complete a
single school services or other
State examination … and on
top of that to pursue her dole
politics to win votes her
Government has taken loan of
C10.54 lakh crore in the past 10
years … tomorrow she will
leave Bengal an insolvent State.”
The State BJP women’s
wing on Thursday staged state-
wide protests against post-poll
violence and rape of saffron
supporters. In Thursday’s agi-
tation BJP MLA Agnimitra
Paul was arrested.
'LGLVODPV%-3IRUSROLWLFLVLQJ836
#!!a]fdgZ]]RXVd
YZeSjW]``UdZ_FA
0DPDWDZLOOOHDYH%HQJDO
LQVROYHQWVDV6XYHQGX
²2WPbcPZT][^P]
^UC $#[PZWRa^aT
X]cWT[Pbc hTPab³
1XWPa=6
R^]SdRcbb^RXP[
fT[UPaTPRcXeXcXTb
18,+DDW
GHYHORSHGIRU
UXUDOZRPHQ
?=B Q =4F34;78
Ifeel like I am losing one of the
lions that guarded the judi-
cial institution, Chief Justice
NV Ramana said on Thursday
while paying glowing tributes
to Justice Rohinton Fali
Nariman on his superannua-
tion after over seven years at
the Supreme Court bench.“I
think there is no need to elab-
orate the impact brother Justice
Nariman has had as a Judge of
this Court. As a judge of the
Supreme Court, he has dis-
posed of nearly 13,565 cases.
All I can state is that with
judgments like Shreya Singhal
(by which section 66A of the IT
Act empowering police to
arrest for social media posts
was set aside), his opinions in
Puttaswamy and Shayara Bano,
he has left an indelible mark on
the jurisprudence of the coun-
try.
“His judgments reflect his
erudition, clarity of thought
and scholarly approach. This
institution will surely miss his
knowledge and intellect,” the
CJI said.
Justice Nariman, who
became the apex court judge on
July 7, 2014, disposed of over
13,500 cases and delivered his-
toric verdicts including decla-
ration of privacy as funda-
mental right, setting aside Sec
66A of IT Act provision
empowering arrests, decrimi-
nalising consensual gay sex
and permitting women of all
ages to enter Kerala's
Sabarimala temple.
The CJI said that Justice
Nariman had an “extremely
successful practice” for over 35
years as a lawyer and was only
the fifth lawyer to be directly
elevated to the bench of the
apex court. In the absence of
Attorney General KK
Venugopal, the Solicitor
General Tushar Mehta deliv-
ered his farewell speech in the
virtual function and recalled
the fact that Justice Nariman
was the first lawyer briefed by
him in the apex court.
“I wish your Lordship a
happy, healthy and fulfilling life
ahead and in the third innings
of his life,” the law officer
said.
“Thank you Solicitor,”
Justice Nariman replied. Justice
Nariman delivered with path-
breaking verdicts including
declaring privacy as a funda-
mental right, setting aside an IT
Act provision enabling easy
arrests, decriminalising con-
sensual gay sex and permitting
women of all ages to enter
Kerala's Sabarimala temple.
Justice Nariman, the illustrious
son of noted jurist Fali
Nariman, is an ordained Parsi
Priest and among the select
company of five lawyers who
directly joined the apex court
bench leaving a very successful
career as an advocate on July 7,
2014.
C=A067D=0C70Q D108
Holding that growing population was
coming in the way of development in
the country, Maharashtra Navnirman Sena
(MNS) chief Raj Thackeray on Thursday
rooted for initiating population control mea-
sures compulsorily in the country.
“Since population has become a major
impediment in the development process,
time has come to control population in the
country. Until we look at the issue of pop-
ulation carefully and do something about
it, we will not be able to deal with devel-
opment issues effectively. If we people do
not agree to take population control mea-
sures themselves, then we will have to make
population control compulsory in the
country,” Raj said.
While participating in a programme
organised by a leading Marathi television
channel, the MNS chief created a sensation
in the state political circles by speaking about
the population control issue.
“I have spoken to some leaders at the
Centre on the need for controlling popula-
tion in the country. I do not know why peo-
ple are afraid to talk about this issue. I am
given to understand that some thinking has
already started at the Centre,” Raj said.
The MNS chief said that the people
should realise that they stood to benefit if
they had less number of children. “The issue
should not be looked at from the angle of
religion. Be it Hindus or Muslims, there
should be uniformity when it comes to pop-
ulation control,” he said.
Coming up with logic of his own while
pushing for population control in the
country, Raj said: “There is a ban on driving
vehicles under the influence of alcohol. If
people are booked in such cases, they are
either fined or sent to jail. Because, the num-
ber of people driving vehicles under the
influence of alcohol has come down.
Similarly, if we are to achieve good objec-
tives, we need to make certain things com-
pulsory”.
Holding politicians responsible for the
phenomenal growth of population in the
country, Raj said: “Irrespective of affiliations,
the political parties should come together
and work towards building a consensus on
the issue. For instance, thanks to the pop-
ulation growth, many small places in
Maharashtra have now become towns with
large populations”.
Replying to a question, Raj said: “What
is progress all about? I do not think build-
ing roads, bridges and seeing mobile phones
in the hands of people can in any way be
called progress.
The question we have to pose ourselves:
have we made any progress as a country in
terms of thinking? What is the barometer
for progress in the country? Even now, the
electoral issues have not changed. We still
talk about good roads, electricity and edu-
cation. That being the case, where is the
progress that we have made has all
gone?”.
The MNS chief slammed the successive
governments in the state for continuing to
regularise slums in Mumbai over the
years.”Initially the cut-off deadline for reg-
ularising the slums was 1990, then it was
1995, 2000,2005 and 2020. Keeping their
political vote banks in mind, the successive
governments continued to extend the cut-
off year to regularise the slums. When will
this slum regularisation game end? If we
continue like this, we will destroy Mumbai.
This is the state of affairs in all cities in the
country. As a result, taxpayers are not get-
ting what they want,” he
said.
?=B Q =4F34;78
Vaccines against Covid-19 that
were developed by US drug
makers Pfizer and Moderna may
not be as effective against the
'Delta' variant compared to as they
were against the original strain of
the virus, a new study has suggest-
ed.
However, the jabs are still effec-
tive in preventing hospitalizations
and severe cases from the virus,
with both having a hospitalization
rate of under 25 per cent, the
researchers from the Mayo Clinic
in Minnesota, US, wrote in the
study, not yet peer-reviewed, and
published on pre-printer server
medRxiv.org said.
The Pfizer-BioNTech vaccine
was only 42 per cent effective
against infection in July, while the
Moderna vaccine was only 76 per-
cent effective, they said.Comparing
rates of infection between matched
individuals fully vaccinated with
mRNA-1273 (Moderna Covid vac-
cine) versus BNT162b2 (Pfizer
Covid vaccine) across Mayo Clinic
Health System sites in multiple
states (Minnesota, Wisconsin,
Arizona, Florida, and Iowa),
mRNA-1273 conferred a two-fold
risk reduction against breakthrough
infection compared to BNT162b2,
the researchers said.For the study,
the team gathered data on more
than 25,000 Minnesotans from
January to July.
From January to June, the vac-
cines as claimed remained effective
around 90 percent, but began dip-
ping in June and largely dropped in
July as the variant took hold in the
US.The change in vaccine effec-
tiveness corresponds with a massive
surge in the prevalence of the
Delta variant in Minnesota, grow-
ing from 0.7 percent prevalence in
May to more than 70 percent in
July, the study showed.Meanwhile,
the 'Alpha' variant, the previous
dominant strain in the US,
decreased in prevalence from 85
percent to 13 percent over the same
time period.The US is currently see-
ing a spike in infections and death
due to the Delta variant. As of
Thursday morning, the overall
caseload and death toll in the US
stood at 36,185,761 and 618,454,
respectively, according to Johns
Hopkins University.
It is projected to increase in the
coming weeks.Last month, Pfizer
published data that showed that its
vaccine's efficacy drops to 86 per-
cent after six months. But booster
shots, expected to be rolled out
soon, can help enhance immunity
to the virus and protect against
more resistant variants.Ends
C=A067D=0C70Q D108
In a cause for concern, the Covid-
19 deaths in Maharashtra on
Thursday crossed 200-mark to
touch a fatality tally of 208 after a
gap of nearly two weeks and the
infections climbed to 6,388, even
as the state achieved a records of
sorts by doing more than a stag-
gering 5 crore Covid-19 tests since
the pandemic broke out in March-
April last year.
A day after the state logged 163
deaths and 5560 infections, the
daily deaths went up by 45, while
the infections rose by 828.
The increase in the daily
deaths should be seen in the con-
text of the fact that the state had
recorded 225 deaths on July 31.
With 208 fresh fatalities
reported on Thursday, the total
number of deaths in the state
increased from 1,34,364 to
1,34,572, while the infections --
with 6,388 new cases – rose from
63,69,002 to 63,75,010.
As 8,390 patients were dis-
charged from the hospitals across
the state after full recovery, the total
number of people discharged from
the hospitals since the second
week of March last year increased
from 61,66,620 to 61,75,010. The
recovery rate in the State
rose from 96.82 per cent to 96.86
per cent.
The total “active cases” in the
state dropped from 64,570 to
62,351. The fatality rate in the state
rose from 2.1 per cent to 2.11 per
cent. Pune with 14,423 active
cases emerged as the first in the
state in terms of maximum num-
ber of “active cases” in the state,
while Sangli with 7,027 stood sec-
ond, followed by Satara (6573),
Thane (6133), Ahmednagar
(4964), Solapur (4533), Kolhapur
(4245) and Mumbai (3208).
Of the 5,03,26,812 samples
sent to various laboratories across
the state so far, 63,75,390 have test-
ed positive (12.67 per cent) for
Covid-19 until Thursday.
Currently, 3,98,397 people are
in home quarantine while 2,507
people are in institutional quar-
antine.
APY)2^_d[b^ah_^_d[PcX^]
R^]ca^[TPbdaTb]TRTbbPah
²;^bX]V^]T^UcWT
[X^]bcWPcVdPaSTS
YdSXRXP[X]bcXcdcX^]³
0DKDGHDWKVULVHWR
^STa]P%TUUTRcXeT
PVPX]bc2^eXS (3T[cP
ePaXP]c?UXiTa#!)BcdSh
1T]TUXRXPaXTbfPXcX]P`dTdTc^aTRTXeT2^eXS (ePRRX]TS^bTPc4aP]PZd[P6T]TaP[7^b_XcP[X]:^RWX^]
CWdabSPh ?C8
0bcX[cPccWT?d[XRPc;PZTX]BaXWPaXZ^cP^]CWdabSPh ?C8