1. 20?BD;4
B2FAA843E4A
;4=6C7H0A6D4=CB
=Tf3T[WX) CWTYdSXRXP[bhbcT
TgXbcbU^acWT°R^^]P]±
cWTBd_aTT2^dac^QbTaeTS^]
CWdabSPhfWX[TTg_aTbbX]V
R^]RTa]^eTa[T]VcWhPaVdT]cb
Qh[XcXVP]cbcWPcc^^SdaX]VcWT
2^eXScXTbP]SbPXSaTbcaXRcX]V
cXTU^a^aP[bdQXbbX^]b]TTSb
c^QTT]U^aRTSCWTP_TgR^dac
P[b^bPXSXcfPbPfPaT^U°T`dP[
aTb_^]bXQX[Xch^UcWXbbXST^UcWT
QT]RW±
?=BQ =4F34;78
The first meeting of the new
Modi Cabinet on Thursday
approved the C1 lakh crore
fund for disbursement among
farmers through Agriculture
Produce Marketing Committee
(APMCs) to provide a medium
to long term debt financing
facility for investment in viable
projects for post-harvest man-
agement infrastructure and
community farming assets
through interest subvention
and financial support.
The scheme, C1 lakh crore
fund, will be provided by banks
and financial institutions as
loans to primary agricultural
credit societies (PACS), mar-
keting cooperative societies,
farmer producers organisa-
tions (FPOs), self-help groups
(SHGs), farmers, joint liability
groups (JLG), multi-purpose
cooperative societies, agri-
entrepreneurs, start-ups, aggre-
gation infrastructure providers
and Central/State agency or
local body sponsored public-
private partnership projects.
Loans will be disbursed in
four years starting with the
sanction of C10,000 crore in the
current year and C30,000 crore
each in the next three years.
The fund was announced
in the Union Budget, but it was
approved on Thursday with
some modifications.
Amid the ongoing farmers’
protest, the Government also
asserted that the procurement
system on the minimum sup-
port price (MSP) and APMC
market yards will stay and
rather be strengthened.
The decision has come
amid decision of farmer unions
to intensify their strike during
the Monsoon Session of
Parliament.
This is the first major deci-
sions after mega reshuffling of
the Modi Cabinet to woo the
protesting farmers. The
Government has once again
appealed to farmer unions to
end their protest and resume
talks on provisions of three new
farm laws, but ruled out repeal
of these Acts.
Addressing a Press confer-
ence following the first Union
Cabinet meet after the rejig,
Union Agriculture Minister
Narendra Singh Tomar assured
that APMCs will continue be
strengthened.
?=BQ =4F34;78
Amid a row between the
Central Government and
Twitter, newly sworn-in Union
Information Technology (IT)
Minister Ashwini Vaishnaw
on Thursday said all those
who live and work in India will
have to abide by the rules of the
country.
He was responding on
Twitter’s stand-off with the
Government over the new IT
rules while talking to reporters
after meeting BJP general sec-
retary (Organisation) BL
Santhosh at the party office.
:D0A274;0??0=Q :278
Amid the Covid-19 pan-
demic that has hit Kerala
hard, the State has a new worry
on hand. On Thursday, a con-
firmed case of the deadly Zika
virus was diagnosed in the
State while tests reports of 19
others were awaited.
However, unconfirmed
reports said that as many as 13
cases of Zika infection have
been detected in the State.
The detection of Zika virus
has come at a time when the
State has not been able to con-
tain the second wave of Covid-
19. On Thursday, the State
reported 13, 772 new cases of
Covid-19 and 142 deaths. State
Health Minister Veena George
said the Test Positivity Rate
stood at 10.83 per cent, slight-
ly higher than the 10.36 per
cent registered on Wednesday.
The Minister said as on
Thursday 1.1 lakh persons
were undergoing treatment for
Covid-19 in the State.
78C:0=370A8Q 90D
After remaining peaceful for
about four months, the
Line of Control (LoC) between
India and Pakistan is once
again hotting up.
Two Indian Army jawans
were martyred, while two ter-
rorists were eliminated during
a fierce gunfight near Dadal vil-
lage of Sunderbani along the
LoC in Rajouri district on
Thursday. Since February 25,
2021, the day India and
Pakistan had decided to strict-
ly adhere to the ceasefire agree-
ment no major incident of ter-
rorist related violence was
reported along the LoC.
Even Army Chief General
MM Naravane on July 1 had
maintained that there had been
a marked change since the
ceasefire agreement as there
had been no infiltration from
across the LoC.
According to official
sources, “After infiltrating
inside the Indian territory, a
group of terrorists had been
hiding in the area since June 29.
Soon after their movement
was recorded in the forward
area the counter infiltration
grid was activated and a mas-
sive cordon and search opera-
tions were launched in the
thickly forested area to track
down their footprints.
0?Q C:H
Fans were banned from the
pandemic-postponed Tokyo
Olympics which will open in
two weeks, following a state of
emergency on Thursday,
Olympic Minister Tamayo
Marukawa told the Japanese
news agency Kyodo.
The ban was announced by
the International Olympic
Committee and Japanese
organisers, reducing the games
to a made-for-TV event.
Fans from aboard were
banned months ago, and the
new measures announced by
Japanese Prime Minister
Yoshihide Suga will clear
venues around Tokyo —
indoor and outdoor — of any
fans at all.
The emergency declara-
tion made for a rude arrival in
Japan for IOC President
Thomas Bach, who landed in
Tokyo on Thursday just hours
before the new measures were
announced.
8`gecVRTYVd`fee`ZdR_
hZeYC=TcWf_UgZR2A4
0XVWDELGHEODZV
RIODQGVDV,70LQ
D]X^]X]XbcTaU^a8]U^aPcX^]
CTRW^]^[^Vh0bWfX]XEPXbW]Pf
PbbdTb^UUXRTX]=Tf3T[WX^]
CWdabSPh ?C8
?=BQ =4F34;78
Gearing up for the impend-
ing third Covid-19 wave,
the Union Cabinet chaired by
Prime Minister Narendra Modi
on Thursday approved a new
C23,123 crore package to ramp
up the medical infrastructure
in the country.
Out of C23,123 crore health
package, C8,000 crore will be
given to the State Governments
in 9 months to ramp up the
infrastructure as per need.
Addressing a press briefing
after the meeting, new Union
Health Minister Mansukh
Mandaviya said the package
“India Covid-19 Emergency
Response Health System
Preparedness Package: Phase-
II” will have provision for ICU
beds, medicines, among other
medical supplies.
Various theories about the
third wave are doing the
rounds with the majority point-
ing out that it may arrive
between August and
December.
It is likely to be more vir-
ulent given that 51 Delta Plus
cases have already been report-
ed from various States amid
apprehension that it is likely to
spread fast with people not fol-
lowing Covid appropriate
behavior.
Giving details, he said
pediatric care centres will be set
up in 736 districts and 20,000
ICU beds will be created under
the Covid relief fund.
C! !Rac^aP_
d_TSXRP[X]UaPU^a
aS2^eXSfPeT
AVUZRecZTTV_ecVd
Z_($'UZded#!
:4FSVUda]R__VU
7ZcdeKZRTRdV
cfSddR]eZ_e`
VcR]R¶dcRXZ_X
4`gZUh`f_Ud
7R_dSR__VUWc`^
@]j^aZTdRdE`j`
f_UVcV^VcXV_Tj
MDZDQVPDUWUHGDIWHU
PRQWKVRI/RFDOP
Srinagar: Four terrorists,
including three from Lashkar-
e-Tayyeba (LeT), were killed in
two separate encounters with
security forces in South
Kashmir’s Pulwama and
Kulgam districts as some parts
of the valley observed a shut-
down to mark the fifth death
anniversary of Hizbul
Mujahideen commander
Burhan Wani on Thursday.
%f]ecRdZ]]VU
Z_dVaRcReV
V_T`f_eVcd
D]X^]X]XbcTaU^a0VaXRd[cdaT
5PaTabFT[UPaT=PaT]SaPBX]VWC^Pa
PSSaTbbTbP?aTbbR^]UTaT]RT^]
2PQX]TcSTRXbX^]bX]=Tf3T[WX ?C8
=Tf7TP[cWX]XbcTaP]bdZWP]SPeXhPPaaXeTbc^PbbdT
^UUXRTX]=Tf3T[WX^]CWdabSPh ?C8
0]daPVCWPZdacPZTbRWPaVTPbcWTX]XbcTa^U8]U^aPcX^]P]S1a^PSRPbcX]VX]=Tf3T[WX^]CWdabSPh AP]YP]3XaXk?X^]TTa
D]X^]X]XbcTaU^a;PQ^da1Wd_T]SaPHPSPePbbdTb^UUXRT
X]=Tf3T[WX^]CWdabSPh ?C8
GRZdY_RhcVda`_Ud`_EhZeeVc¶ddeR_U`WWhZeY8`ge
?=BQ =4F34;78
The Delhi High Court on
Thursday said the
Government is free to take
action against Twitter Inc in
case of any breach of the new
IT Rules even as it directed o
Twitter Inc to file an affidavit,
notarised in United States,
within two weeks on compli-
ance with the new Information
Technology (IT) Rules.
Twitter informed the court
that they have appointed inter-
im chief compliance officer
(CCO) on July 6 and resident
grievance officer (RGO) and
interim nodal contact officer
will be appointed by July 11 and
within two weeks, respective-
ly. Twitter’s advocate Sajan
Poovayya told the court that
Twitter was “actively recruiting
for permanent position”.
“This court has granted
time to Respondent No 2
(Twitter Inc) to file affidavit,
but no protection is granted,” a
Bench of Justice Rekha Palli
said while listing the matter for
further hearing on July 28.
6^ecUaTTc^_d]XbWCfXccTaU^a
QaTPRW^U8Cad[Tb)3T[WX72
A]ZdedU`dU`_¶ed
W`c_VhZ_ZdeVcd
?=BQ =4F34;78
Prime Minister Narendra
Modi on Thursday out-
lined the dos and don’ts for the
new inductees in his Council of
Ministers even as he empha-
sised that the exit of the 12
Ministers was not linked to
performance but was based
on the “need of the hour”. The
PM made it clear that corrup-
tion will not be tolerated and
Ministers should not speak
out of turn to the media.
According to sources, the
Prime Minister also asked the
Ministers not to leave the
national Capital until August
15 and understand, interact
and attend the Monsoon ses-
sion of Parliament with full
seriousness.
The PM first chaired a
meeting of the Union Cabinet
and followed it up with the
Council of Ministers.
Modi said there was no
doubt on the capabilities of the
dropped Ministers and asked
the new appointees to meet
their senior Ministerial col-
leagues to learn about the min-
istries.
He also advised his new
team to take the Government’s
welfare schemes to the ground
among the masses and use
social media for a better reach-
out. It is not unusual for the
Prime Minister to hold Cabinet
and Council of Ministers
meetings to reset the goals
and set new targets just after a
reshuffle.
Modi, in the first meet fol-
lowing the reshuffle, is also
understood to have stressed the
need to recover ground lost in
the wake of Covid-19.
As many as 43 leaders took
oath on Wednesday in the first
reshuffle and expansion after
Prime Minister Modi took up
the reins of the Government at
the Centre for a second time in
May 2019.
News agency ANI quoted
the PM as saying that over the
past few days there have been
pictures and videos of crowd-
ed places and people roaming
about without masks or social
distancing. “This is not a pleas-
ant sight and it should instill a
sense of fear in us,” the PM said.
Modi added that in such a
time, there should be no space
for carelessness or complacen-
cy. A single mistake would
have far-reaching impacts and
weaken the fight to overcome
Covid-19.
7KHGURSSHGZHUH
FDSDEOHEXWWKHH[LW
ZDVQHHGRIWKH
KRXUVDV0RGL
/CWT3PX[h?X^]TTa UPRTQ^^ZR^SPX[h_X^]TTa
7`]]`hfd`_+
fffSPX[h_X^]TTaR^
X]bcPVaPR^SPX[h_X^]TTa
;PcT2Xch E^[ $8bbdT '%
0XaBdaRWPaVT4gcaPXU0__[XRPQ[T
?dQ[XbWTS5a^
34;78;D2:=F 17?0;17D10=4BF0A
A0=278A08?DA 270=3860A7
347A03D= 7H34A0103E890HF030
4bcPQ[XbWTS '%#
51,1R5HJQ877(1*5(*'1R8$'2''1
347A03D=5A830H9D;H (!! *?064B !C!
@A:?:@?'
74?ACA0H434C8=B
=0CDA0;;H0B54F2D;3
DA@CE
4=6;0=3A4027
4DA!!58=0;
m
m
H@C=5)
0545542C)?0:CBC0AC
A468BCAH5A5A486=4AB
7??42I5
?7819B*
F1BE481G1
! F9F139DI
2. ]PcX^]!
347A03D=k5A830H k9D;H (!!
3ULQWHGDQGSXEOLVKHGE$MLW6LQKDIRUDQGRQEHKDOIRI0.3ULQWHFK/WGSXEOLVKHGDW8QLJDWH*HQHUDO0HGLD3YW/WG2OG1HKUXRORQ2SS8WWDUDNKDQG-DO6DQVWKDQ'KDUDPSXU'HKUDGXQ3K0RE DQGSULQWHGDW$PDU8MDOD3XEOLFDWLRQV/WG3ORW1R+WR+6HODTXL,QGXVWULDO
$UHD'HKUDGXQ8WWDUDNKDQG(GLWRUKDQGDQ0LWUD$,5685+$5*(RI5H(DVWDOFXWWD5DQFKL%KXEDQHVZDU1RUWK/HK:HVW0XPEDL $KPHGDEDG6RXWK%DQJDORUH KHQQDLHQWUDO.KDMXUDKR'HOKL2IILFH1R%HKLQG*XODE%KDZDQ %DKDGXU6KDK=DIDU0DUJ1HZ'HOKL3KRQH
RPPXQLFDWLRQ2IILFH)6HFWRU12,'$*DXWDP%XGK1DJDU83
3KRQH /XFNQRZ2IILFHWK)ORRU6DKDUD6KRSSLQJHQWUH)DL]DEDG5RDG/XFNQRZ7HOHSKRQHV
$OWKRXJKHYHUSRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHOIRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULWRIRUELQGLQJLQDQZDRQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQUHVSRQVLELOLWIRUDQ
GDPDJHRUORVVWRDQSHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQDFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULIDQGVHHNDSSURSULDWHDGYLFHWRVDWLVIWKHPVHOYHVDERXWWKHYHUDFLWRIDQNLQGRIDGYHUWLVHPHQWEHIRUH
UHVSRQGLQJWRDQFRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQHPSORHHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQNLQGRIFODLPPDGHEWKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQNLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV
?=BQ B78;0
Atowering figure in
Himachal Pradesh,
Virbhadra Singh, who was
famously known as “Raja
Sahib” passed away in the wee
hours on Thursday, marking
the ending of an era in the
northern hill state where he
dominated the politics for
almost six decades.
The longest-serving Chief
Minister of Himachal and
Congress veteran had con-
tracted COVID-19 twice, once
in April and then in June. After
a month-long battle with the
deadly virus, he succumbed to
COVID-related complications
at IGMC, Shimla.
The death of Virbhadra
Singh (87) has left a big vacu-
um in the Congress and will
affect the party's dream of
bouncing back in the 2022
State Assembly Polls as no
other leader enjoys the kind of
mass appeal and popularity
that “Raja Sahib” did across
Himachal. Singh, a nine-time
MLA and five-time Member of
Parliament, was Himachal’s
Chief Minister for six terms
since 1983. He also remained
the leader of Opposition
between March 1998 and
March 2003. The veteran
leader also served as Union
Minister.
He represented Arki con-
stituency in Solan district in
the present State Assembly.
A scion of the Rampur-
Bushahr royal family, Singh
will be cremated at his native
place, Rampur on Saturday.
The mortal remains of the
Congress leader have been
kept at his private residence,
Holly Lodge in Shimla for
people to pay their last
respects.
The body will be taken to
the state Congress office on
Friday and later to Rampur
Bushahr for the cremation.
Singh is survived by his second
wife Pratibha Singh, a former
Member of Parliament, son
Vikramaditya Singh, a legisla-
tor, and two daughters,
Abhilasha, a former High
Court judge, and Aparajita,
who is married to Punjab
Chief Minister Capt
Amarinder Singh’s grand-
son.The Himachal
Government has declared a
three day mourning as a mark
of respect to the former Chief
Minister. A staunch
Congressmen, Singh had start-
ed his political innings at the
age of 27 when he was elected
a MP in 1962. He had been an
MP thrice, in 1967, 1971 and
1980 before he became the state
Chief Minister.
Singh had the experience of
working with four Congress
Prime Ministers -- Indira
Gandhi, Rajiv Gandhi,
Narasimha Rao and
Manmohan Singh.
Born into the royal family
of Sarahan in Shimla district on
June 23, 1934, Singh was anoint-
ed the king at the age of 13 in
1947. He studied at Bishop
Cotton School at Shimla before
graduating with honours from
St Stephen’s College in Delhi.
A Congress veteran, Singh
was often quoted as saying, “I
am a grassroots worker. I have
risen from the ground and my
roots are still firmly stuck here
(in Himachal Pradesh).
Celebrating his 87th birth-
day on June 23, Singh had said
that he was once again ready to
serve the people as his health
was getting better.
During his six decades
political career, the former Chief
Minister survived many battles
including threats from party
rivals, corruption charges and
waning influence within the
Congress.
Before the 2017 elections,
Singh was at war with state
CongresschiefSukhvinderSingh
Sukhu but had managed to
resolve the differences later.
'HPLVHRI5DMD
9LUEKDGUD6LQJK
PDUNVHQGRIDQHUD
?=BQ B78;0
Leaders across the political
spectrum paid rich trib-
utes to former Himachal
Pradesh Chief Minister
Virbhadra Singh, who died in
Shimla in the wee hours on
Thursday due to post-COVID
complications.
The politicians remem-
bered him as a stalwart who
was committed to serving the
people in his long political
career.
The 87-year-old Singh was
a six-time Chief Minister, nine-
time MLA and five-time MP
and former Union Minister.
The Congress veteran had
passed away at the Indira
Gandhi Medical College and
Hospital (IGMCH) here after
a three-month long battle with
post-Covid complications.
President Ram Nath
Kovind, Prime Minister
Narendra Modi, former Prime
Minister Manmohan Singh,
Congress president Sonia
Gandhi and several Chief
Ministers and Union Ministers
were among those who
remembered the veteran
leader.
President Kovind noted
that Singh's long political
career was marked by his com-
mitment to serve the people of
Himachal Pradesh.
In a tweet, the Prime
Minister said, Shri Virbhadra
Singh Ji had a long political
career, with rich administrative
and legislative experience. He
played a pivotal role in
Himachal Pradesh and served
the people of the state.
Saddened by his demise.
Condolences to his family and
supporters. Om Shanti (sic).”
Former Prime Minister
Manmohan Singh in a letter to
Virbhadra Singh's wife
Pratibha Singh said he left a big
vacuum in the Congress, as no
other leader enjoyed the mass
appeal and clout that he did.
Congress president Sonia
Gandhi described him as one
of the tallest stalwarts in the
party and said the veteran
leader leaves behind a legacy of
service rendered for nearly six
decades to the people of
Himachal Pradesh and the
nation.
“Popular for his affable
and grounded nature, he
remained close to people and
brought about far reaching
positive changes through his
administrative acumen, she
said in her condolence mes-
sage.
“He was one of the tallest
stalwarts of the Congress Party
and remained a dedicated
Congress person throughout,
'' she added.
Congress leader Rahul
Gandhi described Singh as a
stalwart, and said his commit-
ment to serve the people was
exemplary till the end.
A number of union min-
isters including Home Minister
Amit Shah, Defence Minister
Rajnath Singh and Transport
Minister Nitin Gadkari
expressed their condolences on
Singh's demise. BJP chief J P
Nadda also sent his condo-
lences.
The Chief ministers of
Punjab, Haryana, Rajasthan,
West Bengal,Himachal and
Delhi also condoled the demise
of the veteran leader.
Himachal Chief Minister
Jai Ram Thakur who visited
'Holy Lodge', the private resi-
dence of Virbhadra Singh and
laid wreath on his mortal
remains said that contributions
of the former CM for devel-
opment of the state were
unprecedented.
He said that Virbhadra
Singh devoted his entire life for
the upliftment of every section
of the society with special
focus on weaker and vulnera-
ble sections. He also played a
pivotal role for the develop-
ment of the country as well as
for the state while serving as
Union Minister at the Centre.
The void created by Virbhadra
Singh’s death would be difficult
to be filled in for the time to
come, Thakur said.
Describing the former
Himachal Chief Minister as an
able administrator and a gen-
tleman who was loved by the
people, Punjab Chief Minister
Amarinder Singh said
Virbhadra Singh was not just
an elder brother but also a
mentor to many to us.
Rajasthan Chief Minister
Ashok Gehlot said Virbhadra
Singh's contribution to the
party and in serving people
would always be remembered.
Former Haryana Chief
Minister Bhupinder Singh
Hooda said he was saddened
by the loss. I am heartbroken
on hearing the news of the
death of my friend, six-time
chief minister and former
union minister Virbhadra
Singh. I shared a personal
relationship with Virbhadra
ji, who was a good human
being and was very affection-
ate. My heartfelt condolences
to his family and supporters.
Glowing tributes, Hooda said
in a tweet in Hindi.
Tibetan spiritual leader
the Dalai Lama also condoled
the death of the former Chief
Minister.
In a letter to Pratibha
Singh, the Dalai Lama wrote:
Dedicating himself to the ser-
vice of others, Virbhadra Singh
led a long and meaningful
life. I admired the way he lis-
tened to people's needs with
deep affection and compas-
sion.
I am personally grateful
for the warm friendship he
showed me over the many
years we knew each other.
Historically there have long
been close ties between the
people of the erstwhile prince-
ly state of Bushahr, to which
'Raja Sahib' belonged, and
their neighbours in western
Tibet. Here in Himachal
Pradesh, Shri Virbhadra Singh,
our longest serving Chief
Minister, will be sorely missed,”
Dalai Lama said in his letter.
Among other leaders who
condoled his death include
Shiromani Akali Dal chief
Sukhbir Singh Badal, former
union minister Harsimrat Kaur
Badal, Haryana Congress chief
Kumari Selja and Rajya Sabha
MP Pratap Singh Bajwa.
The Himachal
Government has declared
three-day mourning on the
demise of Congressman
Virbhadra Singh, who was at
the helm in the state for six
times.A government
spokesperson said that there
shall be no official entertain-
ment during this period.
?aTi?2bP]S^cWTa_^[XcXRXP]b_PhaXRW
caXQdcTbc^U^aTa7?2EXaQWPSaPBX]VW
?=BQ 347A03D=
Chief Minister Pushkar
Singh Dhami said that he
will soon visit Kedarnath to
inspect the construction works
being undertaken there. He
said this while chairing a meet-
ing to review the progress in
Kedarnath reconstruction pro-
ject and the Badrinath master-
plan.
Dhami directed the offi-
cials to speed up execution of
the Kedarnath reconstruction
works and the Badrinath mas-
terplan construction works.
The execution of these works
should be ensured according to
the vision of Prime Minister
Narendra Modi.
The chief minister also
directed officials to expedite
preparation of detailed project
report for beautification of
Badrinathtemplecomplex,river
front development, arrival plaza
and other works there. A dedi-
cated division of the Public
Works Department should be
formed to speed up the con-
struction works, he said.
Tourism secretary Dilip
Jawalkar informed that Rs 170
crore is available for Kedarnath
reconstructionunderwhichfive
construction works are in
progress. The command and
control room, queue manage-
ment system shelter, hospital
building, Sangam Ghat recon-
struction and the
ShankaracharyaSamadhiworks
areinprogress. Worksinthesec-
ond phase of Kedarnath recon-
struction will also be started
soon. Jawalkarinformedthatthe
Badrinath masterplan had been
finalised. There is an arrange-
ment of Rs 250 crore for works
under the masterplan.
4e`Z_daVTeh`cdZ_VURc_ReYd``_
3WPXSXaTRcb
^UUXRXP[bc^U^a?F3
STSXRPcTSSXeXbX^]
c^Tg_TSXcT
R^]bcadRcX^]f^aZ
?=BQ ?8C7A060A7
An RCC bridge collapsed
following heavy rains on
Wednesday night at Kulagad on
the Pithoragarh-Gunji road
affecting traffic to the border
region in Pithoragarh district.
This bridge at Kulagad leads to
the border areas with China and
Nepal including the Darma,
Byas and Chaudas valleys of the
region in Pithoragarh district.
The Pithoragarh district
magistrate Anand Swaroop
informed that due to heavy rain
in the upper reaches of
Dharchula, the bridge on the
Pithoragarh-Gunji road had
been swept away on Wednesday
night due to which the impor-
tant road was closed to traffic.
Officials of the Border Roads
Organisationhadbeeninformed
about the incident on Thursday
morning.Theyhavemanagedto
arrangeforpedestriantrafficbut
willneedtosetupabaileybridge
for vehicles which may take a
few days, said Swaroop.
According to the locals,
about 100 villages in the
Dharchula region have lost road
link after the collapse of the
bridge.
0RRTbbc^Q^aSTa
PaTPPUUTRcTSPUcTa
QaXSVTbfT_cPfPh
QhWTPehaPX]
?=BQ 70A83F0A
About half a
dozen armed
and masked thugs
looted a jewellery
shop during broad
daylight in
Haridwar on
Thursday. The
criminals raided
the Morotara
Jewellers near
Shankar Ashram
intersection which
falls under the
Jwalapur Kotwali
area. According to
sources, the crimi-
nals threatened the staff and
customers at the shop and loot-
ed jewellery and cash valued at
lakhs of rupees. Reaching the
siteonbeinginformedaboutthe
incident, the police questioned
the showroom operator, staff
members and the guard.
Checking the CCTV footage,
the police ascertained that six
persons were involved in the
crime. The place where the
daylight robbery took place is
not far from the homes of for-
mer cabinet minister and cur-
rent BJP State president Madan
Kaushik and cabinet minister
Yatishwaranand. The heist car-
ried out in broad daylight has
raised concern among the locals
regarding the law and order sit-
uation in Haridwar.
3Ph[XVWcWTXbcPcYTfT[[Tah
bW^_aPXbTbP[Pa
?=BQ 70A83F0A
In an incident which has
raised questions at the pur-
pose of some people visiting
pilgrimage places, a group of
tourists were roughed up for
smoking a hookah while sitting
on the steps of the Ganga
bathing ghat in Har Ki Paidi
here. Reportedly from
Haryana, the group of three to
four men was spotted dipping
their feet in the Ganga while
smoking a hookah at Har Ki
Paidi. Members of the Ganga
Sabha reached the site and
roughed up the men, as seen in
a video clip that went viral on
the social media. They were
handed over to the police who
penalised them for disturbing
peace and order.
T]_T]P[XbTSU^a
b^ZX]VW^^ZPW
Pc6P]VPVWPc
?=BQ 270=3860A7
There was no let up in hot
weather conditions in
Punjab and Haryana where the
maximum temperatures were
several degrees above the nor-
mal on Thursday.
Gurgaon in Haryana sizzled
at 43.7 degrees Celsius, six
notches above what is normal
for this time of the year, accord-
ing to the meteorological
department here. Among other
places, Ambala, Hisar and
Karnal recorded their maxi-
mum temperatures at 40.8
degrees Celsius, 42.8 degrees
Celsius and 39.4 degrees Celsius
respectively, up to five degrees
above the normal. Narnaul and
Rohtak witnessed their respec-
tive maximum temperatures at
43.3 degrees Celsius and 41.8
degrees Celsius. In Punjab, the
maximum temperatures of
Amritsar, Ludhiana and Patiala
settled at 40 degrees Celsius,
39.3 degrees Celsius and 41.4
degrees Celsius, up to six notch-
es above normal.
7^cfTPcWTa
R^]SXcX^]b_TabXbc
X]?d]YPQ7PahP]P
3. dccPaPZWP]S
347A03D=k5A830H k9D;H (!!
?=BQ 347A03D=
Adelegation comprising
Teerth Purohits from the
Char Dham and other stake-
holders connected to these
temples met Chief Minister
Pushkar Singh Dhami and
demanded that the government
reconsider the contentious Char
Dham Devasthanam
Management Board. They
demanded that the status before
the formation of the board be
restored.
Meeting Dhami on
Thursday, the delegation
informed him about the issues
that had emerged after the
enactment of the Devasthanam
Board Act. The chief minister
sought related documents from
the Teerth Purohits in order to
help in deciding the future
course of action.
The Devbhumi Teerth
Purohit Mahapanchayat
spokesman Brijesh Sati said
that the delegation requested the
chief minister to restore the ear-
lier arrangement. Dhami was
informed that Teerth Purohits
in the Char Dham shrines were
agitatingsincetheDevasthanam
Board came into existence.
On being requested to
restore the earlier system of
temple management and oper-
ations, the chief minister sought
relevant documents from the
delegation. The Gangotri tem-
ple committee head Suresh
Semwal, Yamunotri Teerth
Purohit Mahasabha head
Purushottam Uniyal and others
were part of the delegation.
Cabinet minister Dhan Singh
Rawat was also present on the
occasion.
It is pertinent to mention
here that while the
Devasthanam Board came into
existence during the tenure of
Trivendra Singh Rawat as chief
minister, the previous chief
minister Tirath Singh Rawat
had said that the state govern-
ment would reconsider its deci-
sion on the Devasthanam
Board. However, no decision
has been taken on this issue so
far.
?=BQ 347A03D=
The newly appointed Health
Minister of Uttarakhand
Dhan Singh Rawat has claimed
that the State would achieve the
task of 100 percent vaccination
by the month of December this
year. He said this while under-
taking a review meeting of the
health department at the state
secretariat on Thursday. The
minister said that the state
government has set a target of
cent percent vaccination till
December 2021 for the safety
of people from Covid-19. He
said that a five member high
level committee at the govern-
ment level would be constitut-
ed for implementation of the
vaccination resolve. This com-
mittee would submit its report
every 15 days to the chief min-
ister.
He added that similar com-
mittees would be set up at dis-
trict level (headed by District
magistrate) and assembly con-
stituency level (headed by local
MLA).
These committees would
oversee the vaccination drive
and other preventive activities
for Covid -19. In the meeting
Rawat directed the officials to
ensure availability of doctors
and other staff at primary
health centres (PHC) and com-
munity health centres (CHC).
He said that all the sanitation
status of all the hospitals of the
state would be reviewed every
15 days. Rawat assured that the
departmental promotion
process would be completed
soon and the medical profes-
sionals and health workers
would be felicitated at every
level.
The minister also sought
information about the deploy-
ment of doctors, technicians
and other staff members and
the Ayushman scheme from
the officials in the meeting. He
was also informed about the
activities of the National
Health Mission (MHM).
The meeting was attended
by the secretary health Amit
Singh Negi, Pankaj Pandey,
MD NHM Sonika, director
general (DG) state health ser-
vices Dr Tripti Bahuguna,
Chief Executive Officer (CEO)
state health authority
Arunendra Chauhan and oth-
ers.
DQGLG1RWHV
%*DMHQGUD6LQJK1HJL
?7=HA4BCA82C8=B
CWTbdaVT^Uc^daXbcbfXc]TbbTS
aTRT]c[hX]cWT_^_d[PaSTbcX]PcX^]b^U
cWT7XP[PhP]bcPcTWPbQa^dVWc
bX[TbQPRZ^]cWTUPRTb^UcW^bT
Pbb^RXPcTSfXcWcWTX]SdbcahP]SWPb
P[b^RaTPcTSP]²P[[XbfT[[³X[[dbX^]
P^]VcWTVT]TaP[_dQ[XRFXcWcWT
aTbcaXRcX^]bU^acWT2^eXS (bcX[[QTX]V
R[PXTSc^QTT]U^aRTSQhcWT
V^eTa]T]cP[QTXcfXcWb^T
aT[PgPcX^]bP]ScWTR^_d[bX^]^U
]TVPcXeTaT_^ac^UAC?2AcTbcbcX[[_TabXbcX]V^]Tf^]STabW^fW^aSTb
^UTaahPZTabUa^^cWTabcPcTbPaTUX]SX]VP]TPbhT]cahX]c^cWTbcPcT
CWTc^da^_TaPc^abPaTaT_^acTS[h_a^eXSX]VUPZTAC?2AcTbcaT_^acbc^
cWTeXbXc^abfXcWb^T^UcWTTeT]X]R[dSX]VXcX]cWTXa_PRZPVTCW^bT
P]]X]VcWTQ^aSTaRWTRZ_^bcbc^^PaTbPXSc^QTbh_PcWTcXRc^fPaSb
cWTc^daXbX]Sdbcah^UcWTbcPcTQhP[[^fX]Vd]aTbcaXRcTST]cahc^cWT
c^daXbcbfXcWb^TVaTPbX]V^U_P[b]Td]STabcP]SbcWTc^aT]cX]V
cXTcWTc^daXbX]SdbcahfT]ccWa^dVWSdaX]VcWT_P]STXR_TaX^SQdc
cWTXa_[XVWc_P[TbfWT]R^_PaTSfXcWcWTW^aaT]S^db_TaX^SSdaX]V
fWXRWRaXcXRP[[hX[[_PcXT]cbfTaTST]XTSPSXbbX^]bX]cWTW^b_XcP[bP]S
fWT]VTccX]V^ghVT]Rh[X]STaU^aVPb_X]V]TPaP]SSTPa^]TbfPb
]^cWX]V[TbbcWP]P]XVWcPaT;TccX]V^UUcWTVdPaSR^d[SQTbdXRXSP[Pc
cWTcXTfWT]cWTSaTPSTSST[cP_[dbePaXP]c^U2^eXS (WPbPSTP]
T]cahX]c^cWTbcPcTP]SfXcWPePbcPY^aXch^UcWT_^_d[PcX^]bcX[[c^QT
ePRRX]PcTS
=4F4@D0C8=B
CWTSTRXbX^]^UcWT19?WXVWR^P]Sc^TUUTRcPRWP]VTX][TPSTabWX_
X]DccPaPZWP]SU^abTR^]ScXTX]U^da^]cWbfWTaTX]Ph^d]V
?dbWZPaBX]VW3WPXWPbQTT]_dcX]cWTSaXeTa³bbTPcR^d_[TSfXcW
aT_[PRX]VeTcTaP]²=XbWP]Z³fXcW0YPh1WPccX]cWTD]X^]R^d]RX[^U
X]XbcTabWPbaTbd[cTSX]P_PaPSXVbWXUcX]_^fTaQP[P]RTX]cWTbPUUa^]
_PachUa^6PaWfP[c^:dP^]aTVX^]=^ffXcWQ^cWcWT2P]ScWT
d]X^]X]XbcTaR^X]VUa^:dP^]cWT6PaWfP[aTVX^]fWXRWPRR^d]cb
U^a# bTPcbX]cWTbcPcTPbbTQ[h^UP__TPab]TV[TRcTSQdccW^bTfW^
PaTfT[[eTabTSfXcWcWTbch[T^UUd]RcX^]X]V^UcWTbPUUa^]_Pach_^X]c^dc
cWPccWTaTPb^]U^acWXbRWP]VTSU^RdbbcTTSUa^cWTQT[XTUX]cWT
_PachcWPcXcXb^]PfTPZfXRZTcX]cWT:dP^]aTVX^]=^f3WPX1WPcc
Sd^f^d[Scahc^R^a]Ta2^]VaTbbbcP[fPac7PaXbWAPfPcX]WXbW^TcdaU
^U:dP^]P]ScWTQPccTah^U[TPSTabfWXRWX]R[dSTbcWT[XZTb^U=XbWP]Z
CBA8P]S88EXYPh1PWdVd]P0]X[1P[d]XBPc_P[PWPaPPi7PaPZBX]VW
P]S3WP]BX]VWf^d[ScPZTRPaT^UcWT6PaWfP[QPbcX^]X]cWTd_R^X]V
PbbTQ[hT[TRcX^]
:49A8´B0E0C0A
CWTb^d[^U3T[WX20aeX]S:TYaXfP[P__TPabc^WPeTT]cTaTSX]c^7PaPZ
BX]VWAPfPccWT_^fTaUd[RPQX]TcX]XbcTa^UDccPaPZWP]S0UcTa
QTR^X]VcWTUXabcX]XbcTa^U?^fTacWXb_^acU^[X^WPbcaPSXcX^]P[[hQTT]
ZT_cQhcWTRWXTUX]XbcTabPQT]Te^[T]c7PaPZP]]^d]RTScWPc
d]Xcb^UT[TRcaXRXchTeTah^]cWf^d[SQTVXeT]UaTT^UR^bcc^cWT
R^]bdTabX]cWTbcPcT1hPZX]VcWT_^_d[Xbc_a^d[VPcX^]cWT
TaRdaXP[X]XbcTaWPb]^c^][hcPZT]cWTfX]S^dc^UcWTbPX[b^U0aXeX]S
:TYaXfP[³b0P0PSX?PachfWXRWWPScP[ZTSPQ^dcX_[TT]cX]V²3T[WX
^ST[³X]DccPaPZWP]SQdcP[b^WPbd_bcPVTS7PaXbWAPfPcfW^c^^WPS
VXeT]²UaTTT[TRcaXRXch³_a^XbT^]RTWXb_PachR^Tbc^_^fTaX]cWT
bcPcT8]WXbUXabcTTcX]VfXcWcWT1PQdb^UWXb]TfST_PacT]c7PaPZ
PbbTacTScWPcWTf^d[SPZTcWTbcPcT_^fTaR^a_^aPcX^]P_a^UXcPZX]V
Q^Shf^d[SX]XcXPcTcWT_a^RTbb^UaTRadXcT]cP]S_a^eXSTUaTTT[TRcaXRXch
c^cWT_T^_[T8cP__TPabWTWPbPPVXRfP]SX]WXb_^bbTbbX^]fWXRW
fX[[T]bdaT_a^UXcPQX[XchP]S_^_d[XbPccWTbPTcXT
?=BQ 347A03D=
Chief secretary Sukhbir
Singh Sandhu chaired the
meeting of the high powered
committee on World Bank
funded Uttarakhand decen-
tralised development project-
phase II (Gramya) here on
Thursday. The committee
members recommended exten-
sion of the contract period with
various technical partner
organisations in the meeting.
The chief secretary said
that focus should be laid on
maximising the achievement of
the project’s aims. He also
directed the officials to ensure
that the project is completed
within the set time frame.
Further, regular monitoring
should be undertaken to ensure
the quality of the works. He
also directed the officials to
ensure that the benefit of the
scheme reaches the maximum
number of citizens, adding
that the local residents should
be provided training so that
employment can be generated
for the locals in this area. The
participation of the general
public should be informed by
informing them about the poli-
cies and programmes of the
project.
The project director Neena
Grewal informed that the main
aim of the project is to ensure
full use of natural resources
with participation of the rural
community in the selected
micro watershed areas of the
state and to increase the pro-
ductivity of dry farming. Works
including natural resources
management, forestation,dig-
ging of trenches, chal-khal and
dug-out ponds are undertaken
as part of the project. A total of
82 micro watershed areas locat-
ed between 700 metres and
2,700 metres altitude have been
selected under this project. As
per the performance indicators,
at present the discharge in the
water sources has increased
from 12.3 per cent to 22.2 per
cent. Further, there has been a
33.2 per cent increase in the
productivity of dry farming.
Against the target of directly
benefitting 40,000 families, this
project has benefited a total of
54,948 families with 64 per cent
of the beneficiaries being
women, informed Grewal.
Secretaries Sowjanya and V
Shanmugham were also pre-
sent along with other officials
concerned in the meeting.
!!gRTTZ_ReZ`_Sj5VTeYZdjVRc+5YR_DZ_XY
?=BQ 347A03D=
The Health and Family
Welfare Minister Dhan
Singh Rawat made a surprise
visit to the Government Doon
Medical College (GDMC) hos-
pital on Thursday evening.
The minister visited the wards
of the hospital and gave neces-
sary instructions to the officials.
Senior officers of the health
department and medical super-
intendent (MS) of the hospital
Dr K C Pant accompanied
Rawat during the visit.
+HDOWK0LQLVWHUYLVLWV
*'0KRVSLWDO
?=BQ 347A03D=
The State Health
Department reported no
death from the novel
Coronavirus (Covid-19) for
the second consecutive day on
Thursday in Uttarakhand. The
authorities reported only 64
new cases and 120 recoveries
from the disease on the day.
The cumulative count of
Covid-19 patients in the state
has now increased to 3,41,023
while a total of 3,26,267
patients have so far recovered
from the disease. In the state
7338 people have so far lost
their lives to Covid -19. The
recovery percentage from the
disease is now at 95.67 and the
sample positivity rate is at 5.95
per cent in the state. The
authorities collected 27,624
samples in different parts of the
state on Thursday.
The department reported
17 new patients from
Dehradun, 13 from Haridwar,
five from Chamoli, four each
from Almora, Nainital, Pauri,
Pithoragarh and Udham Singh
Nagar, three each from
Rudraprayag and Tehri, two
from Champawat and one
from Uttarkashi on Thursday.
No new case was reported
from Bageshwar district on
the day.
The state now has 1,445
active patients of the disease.
Dehradun district is at top of
the table in the list of active
cases with 511 cases while
Bageshwar is in the second
position with 146 active cases.
Nainital has 127, Pauri 124,
Pithoragarh 112, Chamoli and
Champawat 93 each,
Uttarkashi 46, Rudraprayag 45,
Tehri 41, Udham Singh Nagar
42, Haridwar 40 and Almora 29
active cases of the disease.
The state reported four
new cases of Mucormycosis
(Black fungus) and one death
from it on Thursday. A total of
514 patients of the disease
have so far been reported in the
state out of which 103 have
died.
In the ongoing vaccination
drive, the health department
vaccinated 35,955 people in 483
sessions held on Thursday. A
total of 9,69,723 people have
been fully vaccinated so far in
the state while 38,61,709 have
received the first dose of the
vaccine in the state.
RYLG1RGHDWK
UHSRUWHGIRUVHFRQG
FRQVHFXWLYHGDLQ6WDWH
0UXeTTQTaWXVW
[TeT[R^XccTTc^
QTR^]bcXcdcTSU^a
X_[TT]cPcX^]^U
cWTePRRX]PcX^]
aTb^[dcX^]
?DA=8018B7CQ 347A03D=
By making small changes in
our daily life, we can all do
our bit in protecting our envi-
ronment. With the right mind-
set and simple methods,
everyone can contribute to
saving the earth. This was stat-
ed by Dehradun resident
Anisha Madan who has made
simple yet effective changes in
her life and developed a
lifestyle that is aimed at min-
imising the negative impact
on the environment. Madan,
who is a graphic designer, said
that though she was always
inclined towards the topics
that talked about saving the
environment or ways that
might harm the earth, she
never actually did anything
practical about the environ-
mental issues. However, when
Madan started working in the
fashion industry after com-
pleting her studies in fashion
designing, she observed that
lots of chemicals were being
used and tonnes of fabric
were being wasted on a daily
basis which disturbed her.
After this, she started working
as a graphic designer but the
real change happened after she
was diagnosed with
endometriosis in the year
2005. Endometriosis is a dis-
order in which tissue that
usually lines the inside of a
woman's uterus grows outside
the uterus. She said that when
she researched about
endometriosis, she found out
how bleach, synthetic sanitary
napkins, industrial waste and
other chemical by-products
can severely affect our health.
Madan said that being diag-
nosed with endometriosis was
a turning point in her life after
which she gradually started
making small changes to her
lifestyle. Now for over a
decade, she has adopted sev-
eral ways to live a life with
minimum waste generation.
Little changes on a daily
basis can bring a great change
over a period of time. For
instance, we keep our dry
and wet garbage separately.
Wet garbage is used to make
manure at home. We also
separate our dry garbage
under different categories like
e-waste and anything which
can be sent for recycling or
can be reused in any other
way, said Madan. Besides
this, she also uses handbags
and wallets made of fabric
instead of artificial leather. She
also uses a bamboo tooth-
brush instead of a plastic one.
She said that she also avoids
bringing vegetables and ration
supplies in polythenes and
always carries a fabric bag to
carry things. She added that
she grows most of her veg-
etables in her own garden.
Interestingly, Madan even
does not use any bottled
shampoo, soap or talcum
powder. According to her, she
uses a shampoo bar that
comes in paper packaging
and makes Ubtan at home to
wash her face. She said that
she uses alum (fitkari) instead
of talcum powder during
summers.
She also disclosed that
rather than using synthetic
sanitary napkins, she uses
reusable sanitary napkins, dis-
posable cloth napkins and
menstrual cups. A woman on
average uses several synthet-
ic sanitary napkins which can
harm the environment. Such
sanitary napkins can also
cause several diseases and
hormonal imbalance in
women if used for a long
time. So women should either
use reusable sanitary napkins
made from cloth which can be
easily made at homes too or
should use menstrual cups,
stated Madan.
She also uses solar energy
for electricity at her home. She
said that installation of a solar
plant is not difficult and any-
one can install it as the gov-
ernment also provides subsi-
dies on its installation. She
also said that though some
might find the installation
cost of solar plants somewhat
expensive but it is worth it in
the long run. Besides con-
tributing to a safer environ-
ment, it also reduces the con-
sumption of electricity to a
great extent. Depending on
the power consumption of a
family, the electricity bill can
also be zero with the use of
solar energy, said Madan.
On being asked about
whether it has been hard to
follow all these things, she said
that nothing seems hard once
we make up our minds. She
said that she is not doing any-
thing extraordinary and
everyone can follow this path
by putting some effort to
bring small changes.
By taking steps to save
the earth, we are actually sav-
ing ourselves. Since we live
here, it is our duty to do as
much as we can to save this
planet, said Madan. She also
opined that children should
also be motivated to take
gradual environment friend-
ly steps like avoiding the use
of single-use plastics and mak-
ing manure at home so that
they continue to carry such
habits to their adulthood too.
CTTacW?da^WXcbTTc2STP]SaTbc^aPcX^]^UTPa[XTaPaaP]VTT]cb
?=BQ 347A03D=
Chief Minister Pushkar
Singh Dhami has directed
officials to hold detailed dis-
cussions with neighbouring
states and then take a decision
on the Kanwad Yatra. The chief
minister said this while chairing
a meeting in the secretariat
regarding the Kanwad Yatra. He
directed the officials to hold
deliberations with the neigh-
bouring states and consider all
aspects to reach a decision on
the Kanwad Yatra. It is pertinent
to mention here that lakhs of
people travel to Uttarakhand
where they collect water from
the Ganga mostly in Haridwar
to offer to lord Shiva at temples
in their respective hometowns.
While most cover long dis-
tances on foot, many also trav-
elbyvehicles.TheUttarPradesh
government recently decided
to allow the Kanwad Yatra from
later this month with Covid
restrictions. Along with UP,
many from the NCR, Haryana
and Punjab among other states
undertake the Kanwad Yatra to
Uttarakhand.
Chief secretary Sukhbir
Singh Sandhu, additional chief
secretariesRadhaRaturi,Anand
Bardhan, director general of
police Ashok Kumar, Garhwal
commissionerRavinathRaman,
secretaries Amit Negi, Shailesh
Bagauli, Haridwar district mag-
istrate C Ravishankar and
Haridwar SSP Senthil Avudai
Krishnaraj were among those
present in the meeting.
23WPXSXaTRcb
^UUXRXP[bc^SXbRdbb
:P]fPSHPcaPfXcW
]TXVWQ^daX]VBcPcTb
2B)5^Rdb^]cXT[hR^_[TcX^]`dP[Xch
PgXXbX]VQT]TUXcUa^F1Ud]STS_a^YTRc
³;Xcc[TRWP]VTb^]SPX[hQPbXbRP]bPeTcWTTPacW´
3TWaPSd]aTbXST]c0]XbWPPSP]
WPbPSTbX_[ThTcTUUTRcXeT
RWP]VTbX]WTa[XUTP]SSTeT[^_TS
P[XUTbch[TcWPcXbPXTSPc
X]XXbX]VcWT]TVPcXeTX_PRc^]
cWTT]eXa^]T]c
4. ]PcX^]#
347A03D=k5A830H k9D;H (!!
?=BQ =4F34;78
Almost 30 years ago,
Madhav Rao Scindia han-
dled the Ministry of Civil
Aviation during the PV
Narasimha Rao regime from
1991 to 1993. His son
Jyotiraditya Scindia on
Thursday took charge of the
same Ministry in the Narendra
Modi Government.
It could be a real test for
Scindia as he steps into the
shoes of his father. Amid pan-
demic, airlines are still strug-
gling to survive as flights have
drastically reduced all over the
world with passenger traffic,
fuel prices, rising debt levels,
high taxation, and the uncer-
tainty of when a recovery can
be expected. This even as inter-
national flights too have been
banned since March last year.
Bringing passengers traffic
to pre-Covid era, privatisation
of debt-laden Air India, law-
suits by Cairn Energy and
Devas Multimedia, both seek-
ing to recover their dues from
the Indian Government, are
attempting to seize Air India’s
overseas assets are major issue
before the civil aviation minis-
ter. Besides, modernisation of
airport will be another issue to
be addressed in the coming
days. “I thank Prime Minister
Sh @narendramodi ji,
@JPNadda ji the party lead-
ership for entrusting me with
the responsibility to serve as
civil aviation minister,” Scindia
said on Twitter. “Looking for-
ward to working under the
guidance and vision of the PM
to build a strong aviation sec-
tor for Aatmanirbhar Bharat!”
he added.
When Modi was sworn in
as the Prime Minister in 2014,
Ashok Gajapathi Raju from ally
Telugu Desam Party (TDP)
was sworn in as the civil avia-
tion minister. With TDP with-
drawing support to the gov-
ernment in March 2018, Suresh
Prabhu became the Minister
for Civil Aviation. Both these
positions were in the Cabinet
Rank.
All along there were two
Ministers of States, first
Mahesh Sharma and later
Jayant Sinha. In 2019, in the
second tenure of the BJP-led
government - the Ministry of
Civil Aviation saw Hardeep
Singh Puri lead it but as
Minister of State with
Independent Charge.
;f_Z`cDTZ_UZRWZ]]dWReYVc¶ddY`VdRWeVc$!jcd
?=BQ =4F34;78
Rajya Sabha MP from
Odisha, Ashwini
Vaishnaw, took charge as the
new Railway Minister on
Thursday. After taking charge,
the new Minister said that
Railways is a major part of
Prime Minister Narendra
Modi’s vision and he would
work to make the vision a real-
ity. A former IAS officer,
Vaishnaw also took charge as
Minister of Communications,
and Minister of Electronics
and Information Technology.
“His (PM Modi’s) vision
for railways is to transform
the lives of the people, that
everyone — common man,
farmers, the poor — gets the
benefit of the railway. I will
work for that vision,” said
Vaishnaw.
He said excellent work
has been done in the Railways
over the past 67 years. On
Twitter, the new Minister
thanked Modi for giving the
opportunity to serve the
nation and for that he will
“work relentlessly.” Vaishnaw
major challenge is excute the
High speed rail corridors
including the pending Bullet
Train project besides com-
plete modernization of the
Indian railways.
The Railway Ministry
was earlier under Union
Minister Piyush
Goyal who has been given
charge of the Ministries of
Commerce and Industry;
Consumer Affairs, Food and
Public Distribution; and
Textiles.
Vaishnaw also replaced
Ravi Shankar Prasad, as
Minister of Communications,
and Minister of Electronics
and Information Technology.
The first time Minister has an
MBA from Wharton School,
Pennysylvania University, and
MTech from IIT Kanpur.
Taking the charge of
Communication and IT
Ministry, Vaishnaw held a
meeting with telecom secre-
tary Anshu Prakash and dis-
cussed priority industry issues.
Some of the immediate
challenges for Vaishnaw
include holding fifth genera-
tion (5G) spectrum auctions,
bringing back industry’s con-
fidence, and clearing some of
the regulator’s
recommendations to improve
sectoral health.
?=BQ =4F34;78
Newly appointed Education
Minister Dharmendra
Pradhan on Thursday said
India’s education system has
taken a giant leap with the
introduction of the National
Education Policy (NEP).
Pradhan was given the
education portfolio in a reshuf-
fle-cum-expansion of the
Union Council of Ministers on
Wednesday.
Along with Pradhan,
Rajkumar Ranjan Singh,
Subhas Sekhar and Annapurna
Devi were appointed as
Ministers of State for Education
and they also took charge at
Shastri Bhawan.
In his first meeting as
Education Minister, Pradhan
said, “The Indian education
system has taken a giant leap
with the introduction of NEP,
towards fostering an environ-
ment for creating a future
ready India. The policy has
not only been welcomed in
India but also foreign coun-
tries.”
“We are committed to
making students and the
youth the primary stakehold-
ers in propelling India towards
an equitable knowledge soci-
ety,” he said.
All the new ministers also
participated in a meeting
presided over by Prime
Minister Narendra Modi on
discussion on centrally fund-
ed technical institutions,
including IITs and IISc.
@bQTXQ^*5@XQc
Rb_eWXd]QZ_bSXQ^WU
Y^S_e^dbiµcUTe`_YSi
?=BQ =4F34;78
Soon after taking charge as
Minister of State for
Agriculture and Farmers
Welfare, S Shobha Karandlaje,
on Thursday tried to strike an
emotional chord with the farm-
ing community and said she
will reach out to convince
farmers across the country
about the benefits of three
controversial farm laws.
Thousands of farmers,
mainly from Punjab, Haryana
and western Uttar Pradesh,
have been camping at Delhi’s
borders for more than seven
months now in protest against
the three laws that they say will
end state procurement of crops
at minimum support price.
“The Centre has passed
three agriculture laws in the
interest of the farming com-
munity. However, these laws
are being opposed due to polit-
ical reasons. We have a big
responsibility to convince
farmers about the benefits of
these laws. I will travel to all
states and convince farmers,”
Karandlaje told reporters after
taking charge.
Minister of Agriculture
and Farmers Welfare Narendra
Singh Tomar and Minister of
State in the ministry Kailash
Choudhary were also present
when Karandlaje was taking
charge. She said she will make
efforts to convince farmers
that the farm laws are aimed at
doubling farmers’ income and
removing them from the
clutches of middlemen.
The 55-year-old Karnataka
BJP leader said: “I will respond
to all problems faced by farm-
ers, be it relieving farmers
from debt or drought, working
alongside senior minister
Narendra Singh Tomar ji.”
³CWT2T]caTWPb
_PbbTScWaTT
PVaXRd[cdaT[Pfb
X]cWTX]cTaTbc^U
cWTUPaX]V
R^d]Xch´
?=BQ =4F34;78
Ajay Bhatt on Thursday took
charge as Minister of State
for Defence. After assuming the
new responsibility, he called on
Defence Minister Rajnath
Singh at his office in South
Block.
Defence Secretary Ajay
Kumar and other senior offi-
cials of the Ministry of Defence
received Bhatt and welcomed
him into his office. In a tweet,
the new incumbent thanked
Prime Minister Narendra Modi
for giving him the responsibil-
ity, saying that he will strive to
build the ‘AatmaNirbhar
Bharat’ of the 21st century.
Bhatt is a Member of
Parliament from Nainital-
Udhamsingh Nagar con-
stituency, Uttarakhand. He is
the member of Standing
Committee on Defence;
Consultative Committee,
Ministry of Health and Family
Welfare; Committee on
Subordinate Legislation; Joint
Committee on the Personal
Data Protection Bill 2019 and
Committee on Estimates.
He had earlier served as
Cabinet Minister in
Uttarakhand Government,
holding portfolios such as
Parliamentary Affairs, Health
and Disaster Management. He
was also the Leader of
Opposition in
Uttarakhand Legislative
Assembly.
For his part,
Rajkumar Ranjan Singh
took charge as the
Minister of State (MoS)
in the Ministry of
External Affairs and said “I’m
very happy with the assign-
ment by PM Modi to have
responsibility. I belong to
Northeast India bordering
China, Myanmar and
Bangladesh. We’ve to maintain
good relations with neigh-
bours as advised by the PM. I
will try my best to serve the
purpose.”
The External Affairs
Ministry got another Minister
of State, Meenakshi Lekhi. A
member of Parliament from
Delhi she said, “I am really
thankful to PM, HM party
president JP Nadda for show-
ing faith in my ability, that I
can handle this portfolio.”
1WPcccPZTbRWPaVTPb^BU^a
3TUT]RT;TZWXPb^BX]40
?=BQ =4F34;78
Soon after the new Health
Minister Mansukh
Mandavia assumed the charge
on Thursday, the Congress
sought to know whether there
will be any changes in the
health system and will there be
no shortage of Covid vaccines.
“Does this mean no more
vaccine shortage,” asked former
Congress chief Rahul Gandhi.
Former Union Minister P
Chidambaram said the first
task of the new Health Minister
is to remove vaccine shortage
as some states are facing acute
shortages.
Congress has been criti-
cising the government’s vacci-
nation policy, alleging that it is
moving at a slow pace and
needs to be accelerated.
Congress also said that the
dropping of former Health
Minister Harsh Vardhan is an
admission of the government’s
failure in handling the pan-
demic.
Chidambaram said the
new Health Minister’s first task
is to ensure adequate and unin-
terrupted supply of vaccines.
He said vaccinations have been
suspended at several centres in
Tamil Nadu as vaccines have
run out of supply.
FX[[RWP]VTX]VdPaS
X]7TP[cWX]T]bdaT
PST`dPcTYPQPbZb2^]V
A0:4B7:B8=67Q =4F34;78
The CRPF has warned that
any violation of cyber secu-
rity protocols by its personnel
will attract strict action. The
move comes after a number of
sensitive documents were found
to be circulating on the social
media applications, compro-
mising security.
The recent directive regard-
ing violation of cyber security
instructions and guidelines after
it was noticed by the Force that
correspondences consisting of
classified/sensitive information
like programmes of VIPs/senior
officers, operational plans/mat-
ters, vital information relating
to arms/.ammunition, move-
ment of troops/vehicles, com-
ments of senior officers, reports
on any incident and important
instructions were getting viral
on various messaging applica-
tions.
“Putting out any message
containing sensitive official
information on social media
platforms is not a healthy prac-
tice and amounts to breach of
Official Secrets Act and viola-
tion of various instructions on
the subject, including cyber
security guidelines. Hence, the
Force has decided to deal with
such misconduct in a stern
manner,” a senior official said.
All the formations have
been asked to ensure that all
sensitive messages should only
be communicated on a need to
know basis and should not
reach anyone for whom such
messages are not meant, he said.
Spreading official messages
on various messaging applica-
tions should be strictly avoid-
ed and violation of the instruc-
tions would entail actions as per
the laid down procedures with
zero tolerance.
All the formations have
been instructed to avoid social
media platforms for sending or
receiving official messages and
communication, and instead
only bank on the internal com-
munication system of the CRPF
for sending such documents.
“The growing indiscipline
among the rank and file with
regard to use of foreign mes-
saging platforms compromis-
es operational secrecy and
gives a lever to hostile intelli-
gence agencies to extract sen-
sitive information. Even the
disposition statement (tele-
phone/email directory of the
organization) and deployment
pattern of the Force in various
operational theatres are avail-
able in PDF formats and are
widely circulated amongst the
personnel on messaging apps
like WhatsApp,” another offi-
cial said.
The official further said
that despite cyber security
guidelines being in place, a
few operational/intelligence
meetings have been conduct-
ed online via Skype VoIP-
based videoconferencing
application.
The open availability of
mobile phones numbers and
email IDs of officials have
recently been exploited by
Pakistan’s covert agency Inter-
Services Intelligence (ISI) that
had stepped up espionage
bids to seek information
through spoofed calls on the
Force’s deployment and
strength in Jammu and
Kashmir in the run up to the
drone strikes on the Jammu
air force station.
The footprinting of the
Force’s mobility or location
can easily be tracked by inim-
ical agencies by sending mes-
sages on various messaging
apps of the security personnel,
officials added.
2A?5bcPUUc^UPRTdbXRXUcWTheX^[PcTRhQTabTRdaXch_a^c^R^[b
?=BQ =4F34;78
Prime Minister Narendra
Modi on Thursday inter-
acted with directors of cen-
trally-funded technical insti-
tutions and stressed on the
need to adapt higher and tech-
nical education to the chang-
ing environment and emerging
challenges.
According to a
Government press note, the
PM noted that technological
and RD institutions will play
a major role in the upcoming
decade, and coined as “India’s
Techade”. Interacting with over
100 heads of institutions via
video-conferencing, Modi
highlighted the need to focus
on developing futuristic solu-
tions in the fields of education,
healthcare, agriculture, defense,
and cyber technologies.
The newly appointed
Union Education Minister
Dharmendra Pradhan and the
Ministers of State for
Education Annapurna Devi
and Dr Subhas Sarkar were
also present during the virtu-
al interaction.
The Prime Minister also
lauded the research and devel-
opment work done by these
institutions towards meeting
the challenges posed by the
COVID-19 pandemic and
appreciated the efforts of
young innovators towards pro-
viding quick technological
solutions.
In a tweet, Modi later
said, “Had an enriching
interaction with Directors of
leading IITs and @iiscban-
galore during which we
exchanged thoughts on a
wide range of subjects
including making India a
hub for RD, innovation
and popularising science
among the youth.”
Emphasising the need to
adapt to changing environ-
ment and emerging chal-
lenges, Modi said this
requires the institutions to
reinvent and reevaluate
themselves, develop alterna-
tive and innovative models in
accordance with the present
and future needs of the coun-
try and society.
He stressed that the
country’s higher educational
and technical institutions
need to prepare the youth for
continuous disruptions and
changes, keeping in mind
the fourth industrial revolu-
tion, the PMO said.
He underlined the need
to progress towards educa-
tion models that are flexible,
seamless, and are able to
provide learning opportuni-
ties according to the
requirements of the learners.
?=BQ =4F34;78
India’s top drug regulator has
given go ahead to Sanofi SA
and GlaxoSmithKline Plc for a
late-stage clinical trial of their
protein-based Covid-19 vac-
cine candidate, the drugmakers
said on Thursday.
France’s Sanofi and Britain’s
GSK in May kicked off global
trials to include more than
35,000 adults to test the shot.
They hope to get approvals by
the end of 2021 after early-stage
results showed the vaccine pro-
duces a robust immune
response. The Indian arm of the
studies will enroll roughly 3,000
adults between the ages of 18
years and 55 years, according to
India’s clinical trial registry.
The assessment is expected
to run for a year and the first
enrollment in India is shown to
have been made on Tuesday.
“As the virus continues to
evolve, we are anticipating what
will be needed in the coming
months and years, and accord-
ingly, have adapted our vaccine
development program,”
Annapurna Das, Sanofi’s India
head, said in a statement.
?=BQ =4F34;78B78;0
President Ram Nath Kovind,
Prime Minister Narendra
Modi, Vice President M
Venkaiah Naidu, several Union
Ministers and Chief Ministers
were amongst the leaders who
paid rich tributes and fondly
remembered veteran Congress
leader and former Himachal
Pradesh Chief Minister
Virbhadra Singh who passed
away at his residence in Shimla.
In his condolence mes-
sage, President Kovind said
that his political career span-
ning six decades in his roles as
chief minister and parliamen-
tarian was marked by his com-
mitment to serve the people of
Himachal Pradesh.
“Sad to know that Shri
Virbhadra Singh is no more.
His political career spanning
six decades in his roles as chief
minister and parliamentarian
was marked by his commit-
ment to serve the people of
Himachal Pradesh.
Condolences to family and fol-
lowers,” a tweet from the
Rashtrapati Bhavan said.
Taking to Twitter, Modi
said, “Shri Virbhadra Singh Ji
had a long political career,
with rich administrative and
legislative experience. He
played a pivotal role in
Himachal Pradesh and served
the people of the state.
Saddened by his demise.
Condolences to his family and
supporters”.
Himachal Pradesh Chief
Minister Jairam Thakur also
expressed grief over the death
of Virbhadra Singh and said
that that this is an irreparable
loss for the state, which will
never be compensated.
The Himachal Pradesh
government decided to
observe three days of state
mourning as a mark of respect
to Virbhadra Singh.
Congress President Sonia
Gandhi described Singh as a
stalwart, and said his commit-
ment to serve the people was
exemplary till the end. Former
party chief Rahul Gandhi said
the stalwart leader will be
missed.
Punjab Chief Minister
Amarinder Singh and
Rajasthan Chief Minister
Ashok Gehlot also remem-
bered Virbhadra Singh and
expressed their condolences to
his family.
Former Haryana chief
minister Bhupinder Singh
Hooda said he was saddened
by the loss as he shared a per-
sonal relationship with
Virbhadra. Congress leader
and former union minister
Anand Sharma said he was
deeply saddened by the news
of Singh’s demise.
?)CTRW]^[^VXRP[A3X]bcXcdcX^]bc^
_[PhPY^aa^[TX]d_R^X]VSTRPST
BP]^UXB0P]S
6[Pg^BXcW:[X
]T?[RVTc]^S
U^acaXP[^UYPQ
?aTiE??^cWTab_PhcaXQdcT
c^7XPRWP[Tg2EXaQWPSaP
=TfAPX[fPhbX]e^fbc^
PZT^SXbeXbX^]PaTP[Xch
FX[[R^]eX]RTUPaTabPQ^dc
QT]TUXcb^UUPab[Pfb)X]
5. ]PcX^]$
347A03D=k5A830H k9D;H (!!
?A0344?B0G4=0Q 0;860A7
The families in Aligarh are living
under the fear of child thieves. The
panic is such that innocent children are
kept chained. The root cause behind
this panic is the disappearance of few
children within a week. However, three
of them have been recovered. But now
families are worried about the their
children and are keeping them chained.
The incident started outside Saroj
Nagar as some nomadic families are
staying for a long time near bypass.
Earlier they lived on Etah Chungi. They
work as blacksmiths. Last fortnight, a
3-year-old innocent girl Shivani sud-
denly disappeared from there in the
night. She slept with her mother on the
bed at night. At 4 o'clock in the morn-
ing, the mother saw her missing. In this
matter, a case was registered against
unknown person for stealing the girl
child in Mahua Kheda. However, since
then the parents themself has been
searching for the girl from place to
place. At the same time, the police is
also looking for the girl. But there is no
concrete clue yet.
Now keeping in mind the safety of
other children, the families have invent-
ed a way. At night, while sleeping in the
slum, they tie the children with chains
on the cots with their feet. The purpose
behind this is that even if someone
takes them now or if the child gets up
on his own and goes somewhere, then
there will be the sound of his falling etc.
Accepting this, Liladhar from one
of those families said that it is our com-
pulsion. We have no security arrange-
ments as we live in a slum. Due to this
compulsion, we have taken this step.
Only then can we sleep at night.
Otherwise, after the incident of Shivani,
there was a fear that someone might
steal the child.
Three children went missing from
Lachimpur under Bannadevi police sta-
tion area of the district on wednesday
evening. On this information, the
police immediately swung into action,
under Operation Khushi, in an effort
of two hours, the three children were
recovered and handed over to the
family. The family expressed happiness
when the children returned.
According to CO II Mohsin Khan,
news was received through the police
control room that three children, 8-
year-old Vishal, 6-year-old Kanha and
3-year-old Krishna, son of Dharamveer,
had gone missing from Lachimpur. On
this information, the CO himself and
the Bannadevi police, while trying
under Operation Khushi, made an
announcement from the PA system and
after contacting the people, recovered
the three missing children. The CO told
that after calling the family to the police
station and the children were handed
over to them, the family has expressed
happiness towards the police.
B0D60AB4=6D?C0Q :;:0C0
In a development that could leave many a polit-
ical pundit guessing, Bengal Chief Minister
Mamata Banerjee on Thursday paid a sudden
visit to legendary cricketer and BCCI president
Saurav Ganguly’s Behala residence to wish him
in his 49th birthday.
This is the first time that the Chief Minister
met Ganguly at his residence where she stayed
for about 45 minutes offering the former Team
India captain a bouquet of flowers and meeting
his wife, daughter and mother.
Though the Chief Minister has always
shared a good and cordial relationship with the
former southpaw batsman her visit gains impor-
tance on account of the fact that he also shares
an excellent chemistry with Banerjee’s arch polit-
ical rival and Union Home Minister Amit Shah
the person who is understood to be the man
behind his becoming the BCCI top boss.
While the ruling Trinamool Congress lead-
ership refused to read much into Banerjee-
Ganguly parley a senior party leader and a min-
ister said, “when Didi (elder sister) meets
Dada (elder brother) it must be and it should
be special,” adding, “both Mamata Banerjee and
Trinamool Congress Government knows how
to honour a star performer.” He also wondered
whether there was any phone call or “any match-
ing congratulatory words from the Centre.”
The flurry of greetings started with the one
coming from his good friend and opening part-
ner Sachin Tendulkar who wrote: “My beloved
Dadi. Happy birthday. Wishing you a healthy
and happy year ahead.”
Another legendary cricketer of his times
Virendra Sehwag wrote “Few could match
Dada ka Junoon, Dada ka Iraada . May you be
in good health and spirits always Dada,” while
his cricketing peer Mohammad Kaif tweeted,
“When Dada led you on to the field, you some-
how felt taller. Happy Birthday to the captain
who patted your back when you did well and
put a hand around your shoulder when you did-
n’t.”
Former India opener Wasim Jaffer too tweet-
ed, “He took charge of Indian cricket in its dark-
est hour and led Indian cricket to a new dawn.
Happy Birthday to the ultimate leader of men.”
The BCCI president had led India to the
World Cup final in 2003, retired from interna-
tional cricket in 2008, finishing as the best left-
hand batsman and one of the most successful
captains across Tests and ODIs for India. He had
played 113 Tests and 311 ODIs for India, scor-
ing more than 18,000 runs and scoring 39 hun-
dreds.
Kolkata: The Enforcement Directorate investi-
gating the multi-crore coal scam along with the
Central Bureau of Investigation is known to have
summoned at least seven IPS officers from Bengal.
The issuance of summons comes amid ongoing
bitter rivalry between the BJP-led Centre and
Mamata Banerjee’s Bengal government.
According to sources the officers who have
been summoned by the ED are in the rank of
Additional Director general, Deputy Inspector
General and Superintendent of Police. According
to sources a top police officer from Asansol-
Durgapur Commissionerate to have been sum-
moned along with the other officers --- some of
whom have already been quizzed by the CBI in
the coal and cow-smuggling cases.
The coal and cattle smuggling rackets became
a major electoral issue in the recently held
Bengal Assembly polls which saw TMC roaring
back to power. The central agencies had earlier
interrogated the wife of TMC general secretary
and MP Abhishek Banerjee leading Chief Minister
Mamata Banerjee to come down heavily on Prime
Minister Narendra and Home Minister for their
alleged “vendetta politics.” PNS
'LGLYLVLWV'DGD¶VKRXVH
RQKLVWKELUWKGD
('VXPPRQV
%HQJDO,36PHQLQ
FRDOVFDPSUREH
C=A067D=0C70Q D108
Aday after his son-in-law
Girish Chaudhary was
arrested for alleged money
laundering in the much-dis-
cussed Pune land deal case,
senior Nationalist Congress
Party leader Eknath Khadse
was grilled by the Enforcement
Directorate (ED) for nine-long
hours in the same case on
Thursday.
Khadse reached the ED
office at 11 am and was allowed
to go at 8 pm.
Sixty-eight-year-old
Khadse boarded his SUV and
left for his home, without inter-
acting with the waiting media
persons.There is no confir-
mation yet as to whether he has
been summoned again for
questioning in connection with
the with a questionable land
deal in Pune.
Earlier in the morning,
before going to the ED office in
Mumbai, Khadse had said: “
This is nothing but a political-
ly motivated case registered
against me. My family mem-
bers and I are being targeted
politically to defame us.
However, I am cooperating
fully with the probe agencies”.
“Entire Maharashtra is
witnessing what is going on.
This case has already been
investigated five times. The
Anti Corruption Bureau had
given me a clean chit. But it is
still being investigated once
again,” Khadse said.
Meanwhile, coming out in
support of Khadse's support,
State NCP president and senior
minister Jayant Patil said:
“Khadse has been wrongly
implicated in the case. He is
innocent. He will come clean in
the case”.
The allegation that Khadse
is that that he, wife Mandakini
and son-in-law Girish
Chaudhary had hatched a con-
spiracy and purchased a 3-acre
plot of land at Bhosari near
Pune owned Maharashtra
Industrial Development
Corporation (MIDC) in the
name of his kin for Rs 3.75
crore as against the market
price of Rs 40 crore. The deal,
according to ED, has caused a
loss of Rs 61.25 crore to the
public exchequer.
On his part, Khadse had
denied that he had indulged in
any wrong doing in the Pune
land deal case.
Trouble had begun for
Khadse -- a former minister in
the previous saffron alliance
government in the state, after
he resigned from the BJP on
October 21, 2020 and joined
the ruling NCP two days later.
Around the time when he
left the BJP and joined the NCP
in October last year, the the ED
filed an Enforcement Case
Information Report (ECIR)
against Khadse, his wife
Mandakini Khadse, son-in-
law Girish Chaudhry and
Abbas Ukani in the alleged
grab of Maharashtra Industrial
Development Corporation land
at Bhosari village in Pune.
Ukani is the original owner of
the land.
Khadse – who had played
a key role along with late
Gopinath Munde in building
the Maharashtra party unit
after the formation of BJP in
1980 –had then accused former
chief minister Devendra
Fadnavis had indulged in low-
level politics against me for the
past four years. Khadse had
alleged that Fadnavis had
defamed him by making all
kinds of allegations, including
charge of molestation, against
him.
It may be recalled that on
June 4, 2016, Khadse had
resigned from his post as the
State Revenue Minister over
irregularities in the purchase of
a plot of land at Bhosari in
Pune district.
The ED had questioned
Khadse in January this year in
connection with the question-
able Bhosari land in Pune.
Khadse -- who was denied
a BJP ticket to contest the
2019 State Assembly polls from
his home constituency of
Muktainagar in Jalgaon district
of north Maharashtra and
whose daughter Rohini was
defeated in the Assembly polls
--- had for the past four years
made no secret of his frustra-
tions within the BJP.
Khadse was in the isolation
within the BJP ever since June
4, 2016, when he resigned
from his post as the State
Revenue Minister over irregu-
larities in the purchase of a plot
of land at Bhosari in Pune dis-
trict. Later in May 2018,
Maharashtra’s Anti-Corruption
Bureau (ACB) had reportedly
given a clean chit to Khadse in
the alleged Pune land scam
case.
In the run-up to the
Assembly polls, there was con-
siderable speculation that he
might take a stand against the
BJP. There was a likelihood of
his phone having been tapped
during this period. However,
Khadse did not work against
the BJP during the State
Assembly elections.
In December last year
when the ED summoned him
for questioning, Khadse had
said: “The land in the MIDC
deal has been transferred in the
name of my wife. I have
absolutely nothing to do with
this land deal. Earlier, the Anti-
Corruption Bureau, Pune, the
Anti Corruption Bureau,
Nashik, Income Tax depart-
ment and a judicial committee
headed by retired Bombay HC
judge Dinkar Zoting, had
looked into the allegations
against me. Now the ED has
summoned me for questioning.
I will appear before it”.
?=BQ 90D
The Jammu Kashmir unit of the
Bharatiya Janta Party on Thursday
demanded the unfreezing of the 24
Assembly seats falling in Pakistan-
Occupied Kashmir to grant reserva-
tion to people displaced from PoK,
Kashmir Pandits, SCs and STs during
their meeting with the members of the
Delimitation Commission.
The commission arrived here in
Jammu after meeting several delega-
tions and Deputy Commissioners of
three neighbouring districts in
Kishtwar.
Led by JK BJP president
Ravinder Raina, the delegation also
sought adequate representation for
Jammu in the Assembly.
Once the delimitation exercise is
completed, the number of assembly
seats in JK will go up from 83 to 90.
Twenty-four seats of the Assembly
continue to remain vacant as they fall
under PoK.
“We demanded political reserva-
tion for POJK refugees by unfreezing
the eight assembly seats from the
POJK quota, three seats for Kashmiri
Pandits, Scheduled Castes and
Scheduled Tribes and other neglect-
ed people. Jammu, too, must get ade-
quate representation in the assembly,”
Raina said.
The BJP delegation included for-
mer deputy chief ministers Nirmal
Singh and Kavinder Gupta, BJP chief
spokesperson Sunil Sethi and former
legislator R S Pathania
Meanwhile, the National
Conference delegation headed by for-
mer MLA DS Rana from Jammu
region in their memoranda demand-
ed that the delimitation exercise
should be carried out as per the con-
stitutional framework based on the
basic tenets of Delimitation – popu-
lation, geography, topography, area,
physical features, contiguity, conve-
nience of administrative units and
facilities of easy communication and
approachability of public
convenience.
We feel that decentralisation
should form core of democracy, all
regions or sub-regions crave for equal
role in the governance where no one
should nurture a feeling of sub-
servience or discrimination the NC
leaders demanded.
The leaders of the JK Congress
unit also submitted their memoranda
in which they highlighted the vast
diversities of the population and area
of Jammu Region and its various parts
and their respective urges and aspi-
rations of their identity and repre-
sentation in the state legislature.
Former Congress MLC and chief
spokesman Ravinder Sharma said,
The restoration of statehood is para-
mount for any meaningful delimita-
tion and restoration of democracy.
He said we urged the Commission
to adopt a fair and transparent exer-
cise and share the draft proposals in
public domain for any meaningful
inputs by the political parties and pub-
lic. They also urged to keep the
administrative boundaries in mind,
to avoid inconvenience to the
people
They urged the Commission to
recognize and consider the respective
demands of diverse sections of soci-
ety in Jammu like SCs, STs, OBCs,
Paharies, Sikh Minority, POJK
refugees, KPs etc and give them their
rights due to each one of them.
Several other parties including
Panthers party, JKAPNI party, repre-
sentatives of West Pak Refugees led by
Labha Ram Gandhi, SC/ST's, a dele-
gation of Chamber of Commerce
and Industries also submitted their
memoradas seeking justice and ade-
quate representation to the deprived
population of Jammu region.
:D0A274;;0??0= Q :278
The Catholic Church in
Kerala is upset over the
untimely death of Stan Swamy,
the Jesuit evangelist who suc-
cumbed to Covid-19 early this
week in a super speciality hos-
pital in Mumbai.
“Sathya Deepam”, the offi-
cial mouth piece of Catholic
Church in its July 8 issued
described Stan Swamy’s death
as “judicial murder” as well as
an act of “State terrorism”.
The judicial system in this
country cannot wash off its
hands from its role in this cus-
todial murder, said a heart-
rending editorial of the week-
ly. The Church is of the view
that the martyrdom of Stan
Swamy was caused by the lack-
adaisical and go slow approach
of the judiciary which inordi-
nately delayed the verdict of the
bail plea filed on behalf of the
84-year old frail and weak
man, the editorial said.
The editorial said though
he breathed his last in a private
hospital, it remained a custodial
death. “The cold and frozen
body that was lying in St Peters
Cathedral at Bandra in
Mumbai was the dead body of
democratic India,” said Sathya
Deepam editorial.
“The BJP Government that
came to power in the 2014 Lok
Sabha election treated Stan
Swamy as an eye sore. The
Government got furious when
Swamy came to the help of
more than 3,000 tribal youths
who were falsely implicated as
Maoists in criminal cases. The
Jesuit priest was the only source
of help for these innocent and
gullible youths,” said the edi-
torial.
The editorial blames the
supreme bodies like the
Catholic Bishops Conference of
India and Kerala Catholic
Bishops Council for their fail-
ure in condemning the mar-
tyrdom of the priest in the
strongest of words and in not
taking up the issue with inter-
national human rights organ-
isations and the global media.
It also blames the anti-ter-
rorism laws as a façade to
destroy the last vestiges of
human rights and civil rights
from the country. “With peo-
ple like Stan Swamy getting
imprisoned and murdered in
prisons, the country is losing its
identity as a free and indepen-
dent India. This is the new
story from new India. We are
sure to lose more and more
Stan Swamy’s in days to come
as the rulers term activists as
anti socials, a definition used by
fascists,” says the editorial.
7cVV;2ddV^S]jdVRedZ_
A`+3;Ae`UV]Z^ZeReZ`_aR_V]
?=BQ =4F34;78
Amid continued verbal attacks against
Chief Minister B S Yediyurappa, his loy-
alists are ready to head to the national Capital
to meet central leadership, demanding expul-
sion of the 'rebels'.
Encouraged by the inclusion of four
Karnataka Ministers including Yediyurappa's
close associate Shobha Karandlaje in the
Union Cabinet, the 'loyalist group' is planning
to put dissidents on the mat by seeking disci-
plinary action against them.
Yediyurappa supporters are planning to
meet the BJP top brass during the Parliament
session, beginning July 19.
According to Chief Minister's political sec-
retary M P Renukacharya , BJP MLAs will
meet the top BJP leaders in Delhi and demand
for their expulsion.
He challenged Yediyurappa's detractors to
resign and face the election fresh, as he cred-
ited the CM for the party's growth and its com-
ing to power in the state.
Is Yediyurappa a ready-made food? He
has built and nurtured this party. Criticising
Yediyurappa is the same as criticising the BJP,
Renukacharya said at Benguluru.
NewDelhi:Seekingtoreachout
to the farmers and increase
coconutproduction,theCabinet
on Thursday decided to amend
the Coconut Board Act and
appoint a non-official person as
its president by roping in a sec-
tor-expert instead of a bureau-
crat.
“The Coconut Board pres-
ident will be from the farmers'
community, who knows and
understands the work of the
field,” Union Agriculture
MinisterNarendraSinghTomar
said after the cabinet meeting.
“There is a large part of the
country where coconut farming
is done. To increase coconut
farming, we're amending the
Coconut Board Act. Andhra
Pradesh and Gujarat will berep-
resented in the board now,” he
added.
Traditional areas of coconut
cultivation are the states of
Kerala, Karnataka, Andhra
Pradesh and Tamil Nadu. Also,
Maharashtra, Odisha, West
Bengal, Gujarat, Puducherry
and Goa; and the island territo-
ries of Lakshadweep and
AndamanandNicobarareother
areas of coconut production.
About 54 million coconuts are
produced every year across the
globe. In this calculation, India
grabs the 3rd position in its con-
tribution. PNS
?=BQ =4F34;78
India and Italy on Thursday
held bilateral talks on defence
and strategic ties during a meet-
ing between Army Chief
General M M Naravane and his
Italian counterpart Lt General
Pietro Serino and Defence
Minister Lorenzo Guerini in
Rome.
Both the sides focused on
further strengthening defence
cooperation, including military-
to-military engagement.
Naravane arrived in Rome on
Wednesday on a two-day visit
on the second leg of his two-
nation tour of the UK and Italy.
About his meeting with
Italian Defence Minister
Guerini, officials said they
exchanged views on strength-
ening defence cooperation
between the two countries.
General MM Naravane
#COAS interacted with
Lieutenant General Pietro
Serino, Chief of Italian Army
and discussed aspects of joint
military cooperation, the Army
tweeted.
The Army chief is also
scheduled to inaugurate an
Indian Army memorial in the
Italian town of Cassino. The
memorial has been built to pay
homage to Indian soldiers who
losttheirlivesduringWorldWar
II. The talks between the two
army chiefs came after ways to
further intensify defence coop-
eration had figured prominent-
ly at a virtual summit between
Prime Minister Narendra Modi
and then Italian prime minister
Giuseppe Conte in November
last year. The two prime minis-
ters had underscored the need
to further expand defence
engagement through greater
two-waycollaborationandtech-
nology cooperation, including
co-development and co-pro-
duction of military hardware.
Naravane's visit to Italy
comes days after Indian naval
ship INS Tabar and Italian
frigate ITS Antonio Marceglia
carried out a two-day maritime
partnership exercise in the
Tyrrhenian sea.
The exercise on July 4 and
5 covered a wide range of naval
operations,includingairdefence
procedures, replenishment at
sea, communication drills and
cross deck helo operations by
day and night, an Indian Navy
spokesperson said.
6GLVPLVVHV)%,QGLD
93SOHDFKDOOHQJLQJ
'HOKL+RXVHVXPPRQ
9^TYQQ^T9dQi
X_TRYQdUbQdQ[c
DWKROLFKXUFK
XSVHWRYHU6WDQ
6ZDP
VGHDWK
2WX[SaT]QTX]VcXTSfXcW
RWPX]bU^aUTPa^UVTccX]V
ZXS]P__TSX]0[XVPaW
CWTa^^cRPdbTQTWX]ScWXb_P]XRXbcWT
SXbP__TPaP]RT^UPUTfRWX[SaT]fXcWX]P
fTTZ7^fTeTacWaTT^UcWTWPeTQTT]
aTR^eTaTS1dc]^fUPX[XTbPaTf^aaXTS
PQ^dccWTXaRWX[SaT]P]SPaTZTT_X]V
cWTRWPX]TS
(' JULOOV.KDGVHLQ
PRQHODXQGHULQJFDVH
?D=4832;0=3340;
1BHbd__^acTab_[P]]X]V
c^TTc19?c^_QaPbb
2PQX]Tc]^Sc^2^R^]dc1^PaS0RcPT]ST]c
0QPQh^]ZThSaX]ZbfPcTaUa^PcP_X]6dfPWPcX^]CWdabSPh ?C8
?=BQ =4F34;78
The Supreme Court on
Thursday dismissed a
plea filed by Facebook
India vice president and
MD Ajit Mohan challeng-
ing the summons issued
by the Delhi Assembly’s Peace and
Harmony committee for failing to
appear before it as witness in con-
nection with the north-east Delhi riots
last year.
A Bench headed by Justice Sanjay
Kishan Kaul termed Mohan’s plea as
pre-mature saying nothing has hap-
pened against him before the
Assembly panel. Pronouncing the
verdict, Justice Kaul said technologi-
cal age has created digital platforms
which can be uncontrollable at times.
The Bench, also comprising
Justices Dinesh Maheshwari and
Hrishikesh Roy, delivered its verdict
on the plea filed by Mohan, Facebook
India Online Services Pvt Ltd and
Facebook Inc which contended that
the committee lacked power to sum-
mon or hold petitioners in breach of
privileges for failing to appear before
it and had exceeded its constitution-
al limits.
The apex court said the
option of not answering before
the committee cannot be dis-
puted and representative of the
petitioner can deny answering
the question if it falls within
the prohibited domains.
It said the Assembly does not have
the power to legislate on the issue of
law and order which falls under the
Union List in the Constitution. It said
the objective of peace and harmony
goes beyond law and order and police.
The Bench said in the judgement, it
has divided the issues into three cat-
egories - privilege, free speech and leg-
islative competence.
The petitioners had challenged
last year’s September 10 and 18 notices
issued by the committee which sought
Mohan’s presence before the panel
probing the Delhi riots in February
and Facebook’s role in spread of
alleged hate speeches.
The Delhi Assembly had earlier
said no coercive action has been
taken against Mohan and he was only
summoned by its committee to appear
as witness in connection with north-
east Delhi riots.