SlideShare ist ein Scribd-Unternehmen logo
1 von 12
Downloaden Sie, um offline zu lesen
C$;B;0C8DC4027
:8;;438=:´C0:01;0BC
1T]VP[dad):Pa]PcPZP2WXTU
X]XbcTa1BHTSXhdaP__P^]
5aXSPhP]]^d]RTSP
R^_T]bPcX^]^UC$[PZWTPRWc^
cWTZX]^UcW^bTfW^SXTSX]
BWXeP^VVPQ[PbcP]S
PbbTacTScWPcWXb
6^eTa]T]cfPbR^XccTSc^
bc^_P[[
X[[TVP[X]X]VX]cWTBcPcT
C44==4?74F:8;;438=
D?*A0?4BDB?42C43
2WXcaPZ^^c)0 $hTPa^[SVXa[
fPbWPRZTSc^STPcWfXcWP]PgT
P[[TVTS[hPUcTaQTX]VaP_TSP]S
WTaU^dahTPa^[S]T_WTfZX[[TS
X]PeX[[PVTWTaT_^[XRTbPXS^]
5aXSPh0hTPa^[SP]Ua^
cWTVXa[³beX[[PVTWPb
QTT]PaaTbcTSX]
R^]]TRcX^]fXcWcWT
RaXT
20?BD;4
A094B7:D0AQ =4F34;78
Two days after the
Government offered to
keep in abeyance the three
farm laws, the rift widened
between the Government and
farmers’ unions on Friday.
In the 11th round of meet-
ing, farmer unions rejected
the Government’s offer and
insisted on complete repeal of
the three laws.
Both sides hardened their
stands and could not even
reach a decision on the date of
the next meeting.
In the very beginning of
the meeting, farmer leaders
said that they have decided to
reject the proposal to put off
farm laws for 18 months.
Hardening its stand, the
Government asked farmers’
unions that the next round of
talks will only continue if they
agree to accept the proposal by
Saturday. Union Agriculture
Minister Narendra Singh
Tomar said the Centre has
asked farmers to consider its
proposal on the temporary
suspension of the implemen-
tation of the farm laws.
The Minister added that
the next meeting would be
scheduled only after farmers’
unions come back with a
response. He blamed external
“forces” for their rigid stand
and said no resolution is pos-
sible when the sanctity of agi-
tation is lost.
Meanwhile, farmer leaders
alleged even as the meeting
lasted for nearly five hours, the
two sides sat face to face for less
than 20-25 minutes and for the
rest of the time, they were in a
separate rooms. Farmers’ lead-
ers said they felt “insulted” by
the manner in which the
Ministers treated them.
“The Minister made us
wait for three and a half hours.
This is an insult to farmers.
When he came, he asked us to
consider the Government’s pro-
posal and said that he is end-
ing the process of meetings,”
said SS Pandher of Kisan
Mazdoor Sangharsh
Committee, adding that the
agitation will continue peace-
fully.
At the meeting, the Union
Ministers told farmers’ unions
that they have been given all
possible options and they must
discuss internally the propos-
al of suspending the laws.
Sources said the Ministers were
not happy with the farmers’
decision to continue their
demand to hold tractor rally on
Republic Day in Delhi.
“The Government has
given the best, solution-ori-
ented proposal to farmer
organisations. We asked them
to reconsider our proposal as it
is in the interest of farmers and
the country. Talks remained
inconclusive as farmers’ welfare
was not at the heart of talks
from the unions’ side. I am sad
about it. Farmers’ unions said
that they only want the repeal
of the laws despite the
Government asking for alter-
natives. We should remain
hopeful. We asked them to
convey their decision tomor-
row (Saturday). Let’s wait to
hear farmer unions’ final deci-
sion,” Tomar said after the
meeting.
Taking a hardline posi-
tion, the Minister said some
external force was definitely
trying to ensure that the agita-
tion continues and those were
obviously against the interests
of farmers.
“The Government gave
many proposals to end the
protest, but no resolution is
possible when the sanctity of an
agitation is lost,” he said.
Asked whether he expects
farmers to agree to the
Government offer, he said, “I
don’t want to speculate, but we
are hopeful that farmer unions
will consider our proposal pos-
itively.” On whether he saw any
division among the union lead-
ers on the Government pro-
posal, Tomar did not give a
direct reply but said, “We
thanked all farmer leaders,
including those who support
our proposal and those who are
against it.”
During the meeting, farm-
ers alleged the Delhi Police is
trying to harass their leaders.
One of the union leaders
alleged that the rear wind-
shield of his car was smashed
by the Delhi Police. The car
belongs to one Ruldu Singh
Mansa. Darhsan Pal one of its
leaders received a threatening
phone call while Hannan
Mollah was manhandled by
police. As the 11th round of
talks remained inconclusive,
farmer leaders have threat-
ened to intensify their protest.
The break, during which
farmer leaders had their langar
(community kitchen) food,
lasted for more than three
hours. The break also saw 41
farmer leaders holding con-
sultations among themselves, at
times in smaller groups, while
the three Union Ministers wait-
ed in a separate room at Vigyan
Bhawan.
Farmer leader Shiv Kumar
Kakka who was the first to
leave the talks said there was no
headway in the discussions
and the Government asked
unions to deliberate on its pro-
posal again. After the meeting,
Bharatiya Kisan Union
(Ugrahan) leader Joginder
Singh Ugrahan said the dis-
cussions have broken down as
the unions rejected the
Government’s proposal.
Harpal Singh, president of
Bhartiya Kisan Union Asli
Arajnaitik, said, “Even if we
accept the Government’s offer,
our fellow brothers sitting at
Delhi borders will not accept
anything other than a repeal of
the laws. They will not spare us.
What achievement will we
show to them?” He also ques-
tioned the Government’s cred-
ibility, alleging it was difficult
to believe that they will keep
their word on putting the laws
on hold for 18 months.
7Rc^aRc]VjdWRZ]`_^ZdXZgZ_Xd
)DUPHUXQLRQVUHMHFW*RYW¶VSURSRVDOWRSXWIDUPODZVRQKROGLQVLVWRQUHSHDOQH[WWDONVGDWHQRWIL[HGDVULIWZLGHQV
5PaTa[TPSTabSdaX]VTTcX]VfXcWcWT2T]caP[6^eTa]T]c^]]TfUPa[PfbPcEXVhP]1WPeP]X]=Tf3T[WX^]5aXSPh 0?
?=BQ =4F34;78
While a section of health
experts have raised ques-
tions about the efficacy of the
Hyderabad-based Bharat
Biotech’s anti-Covid-19 vac-
cine, Covaxin, a report in The
Lancet Infectious Disease jour-
nal has said the vaccine showed
enhanced immune response
without any serious side effects
in the participants enrolled for
the phase 1 trials.
Bharat Biotech has devel-
oped the vaccine in collabora-
tion with the Indian Council of
Medical Research (ICMR) and
the National Institute of
Virology (NIV), Pune. Covaxin
has been granted emergency
use authorisation (EUA) in
clinical trial mode by the
Government.
Covaxin, which is now
undergoing phase-3 trials, had
raised concerns among experts
over its emergency approval
earlier this month by drug
regulator DCGI.
The vaccine, codenamed
BBV152, was well tolerated in
all dose groups with no vac-
cine-related serious adverse
events, noted the authors of the
study funded by Bharat
Biotech.
The same results were ear-
lier published in the preprint
server medRxiv in
December.
However, there has been
no new data released in the
public domain which could
demonstrate further safety and
efficacy of the preventive.
The authors said all adverse
events were mild and moder-
ate, and were more frequent
after the first dose, adding that
one adverse event was report-
ed but was unrelated to the vac-
cine.
The randomised phase 1
trial to assess the safety and
immunogenicity of BBV152
was carried at 11 hospitals
across the country. Adults aged
18-55 years who were deemed
healthy by the investigator
were eligible. Between July 13
and 30, last year, 827 partici-
pants were screened, of whom
375 were enrolled.
Among the enrolled par-
ticipants, 100 each were ran-
domly assigned to the three
vaccine groups, and 75 were
randomly assigned to the con-
trol group.
Two intramuscular doses
of vaccines were administered
14 days apart. “BBV152 led to
tolerable safety outcomes and
enhanced immune responses.
The vaccine was well tolerated
in all dose groups with no vac-
cine-related serious adverse
events,” the authors of the
study said.
RYD[LQHIIHFWLYHZLWKQR
VLGHHIIHFWV/DQFHWVWXG ?=BQ =4F34;78
Aweek after the first dose of
anti-coronavirus vaccines
was given to front-line health
workers, Prime Minister
Narendra Modi on Friday
interacted with those involved
in the Covid-19 vaccination
drive in Varanasi, his Lok
Sabha constituency, and
assured those anxious about
the safety of the desi vaccines.
Instilling confidence
among those who were vacci-
nated in the first phase of the
vaccination drive in the coun-
try, the PM said there are no
major side-effects of the vac-
cine and that India is absolute-
ly self-reliant in regard to jabs.
The beneficiaries said they
have experienced no side
effects, mental or physical. “If
anything it feels like a normal
injection,” they said.
The Prime Minister,
Ministers and other elected
leaders or “key functionaries”
are expected take shot of the
vaccine in the second phase to
boost the public confidence in
the ongoing vaccination .
The second phase of vac-
cination would focus on the
priority group above the age of
50 in the country. Of the two
available vaccines — Civaxin or
Covishield — every beneficia-
ry will need to receive two
doses of the same vaccine, 28
days apart.
Addressing the beneficia-
ries and those administrating
the shots through video con-
ference, Modi also expressed
pride over the development of
two vaccines in the country to
tackle coronavirus pandemic.
“The biggest vaccination
programme in the world is
going on in our country. Today,
the nation has the willpower to
manufacture its own vaccine -
not one but two Made in India
vaccines. Vaccines are reaching
every corner of the country.
India is absolutely self-reliant in
this regard,” the PM said.
Modi sought to dispel fears
and misconceptions over the
efficacy and safety of Covid
vaccines in an interaction with
health workers in Varanasi,
his Lok Sabha constituency.
“When doctors and health
workers give a clean chit to the
vaccine, it sends a very strong
message among people about
the efficacy of the jab,” he
said.
The PM said politicians or
politics has no role in deciding
the efficiency of the vaccine.
RYLGMDEVHIILFDFLRXV
VDIH30 GLVSHOVIHDUV
?=BQ =4F34;78
The Congress on Friday
announced that the grand
old party will have an elected
president by this June. The
schedule announced by the
party’s working committee will
ensure that the new president
will escape responsibility for
the outcome of the five State
Assembly elections that will be
held in May or before.
After three and a half hours
meeting, the CWC authorised
incumbent interim party chief
Sonia Gandhi to schedule the
internal election after the con-
clusion of Assembly polls in
five States.
Addressing a joint Press
conference to brief details of
the CWC, Congress leaders KC
Venugopal and Randeep
Surjewala said elections to the
CWC will also be held, but it
remains to be seen whether
they can be scheduled before or
after the election to the
Congress chief’s post.
AICC sources said the
Central Election Authority has
proposed the holding of polls
for electing the party president
and AICC session on May 29
and the working committee
discussed the dates but autho-
rised Sonia Gandhi to schedule
them after the Assembly polls.
The CWC passed three
resolutions demanding a repeal
of the three agriculture laws, a
time-bound JPC probe into the
alleged violations of national
security and Official Secrets
Act and another to ensure that
the Government ensures free
time-bound Covid-19 vacci-
nation for the poor and
oppressed sections.
“The CWC decided that
there will be an elected
Congress president by June
2021 at any cost,” AICC general
secretary KC Venugopal said.
He said the little change in
schedule depending on the
State elections will be decided
soon.
“The CWC discussed the
schedule of Congress presi-
dent’s elections in May-end,
proposed by its election author-
ity. All CWC members unani-
mously requested the Congress
president that the internal elec-
tions should not interfere with
the Assembly elections.”
He said the Congress pres-
ident was requested unani-
mously to reschedule AICC
Plenary Session to the end of
June 2021 and the Congress
chief’s election would be con-
cluded by June
2021.
“We will conduct elections
as per the Constitution of the
party. We need a change of
schedule due to Assembly polls
as counting would be under-
way in May,” he said.
Asked about any dissenting
notes on the holding of elec-
tions, Surjewala said, “There
was no dissent at the meeting.”
4`_Xe`XVeV]VTeVUTYZVWSj
;f_VRWeVc2ddV^S]ja`]]d
?=BQ =4F34;78
The CBI has registered a case
against two UK-based
firms — Global Science
Research Limited (GSR), UK,
represented by Dr Aleksandr
Kogan and Cambridge
Analytica, UK, represented by
Alexander Nix — under IPC
Sections relating to criminal
conspiracy and cyber crime
under the Information
Technology Act for the alleged
illegal harvesting of personal
data of 5.62 lakh Indian
Facebook users for commercial
purposes.
Earlier, a Preliminary
Enquiry was conducted by CBI
based on a complaint from
Ministry of Electronics 
Information Technology.
“It was revealed in the
enquiry that the founder and
director of first UK-based com-
pany “Global Science Research
Limited had allegedly created
an app “this is your digital life”
and this app was authorised to
collect specific data of its users
in Facebook (FB) as per their
platform policy. It was alleged
that the app illegally harvested
additional data of FB users and
of their friends on FB,” the CBI
said in a statement.
It was further alleged that
335 Indians had installed the
app and data of approximate-
ly 5.62 lakh FB friends of these
users was harvested in unau-
thorized manner by the app
without their consent, the
agency said.
It was also alleged that the
said company (Global Science
Research Limited) entered into
conspiracy with a second UK-
based company (Cambridge
Analytica) during 2014 and
gave rights to use this illegally
harvested data to the second
company for commercial pur-
pose, it said, adding that the
investigation is
continuing.
218Q^^Zb!D:UXabU^a
WPaeTbcX]V51dbTab´SPcP
B0D60AB4=6D?C0Q :;:0C0
Amid speculation that more
politicians might join the
BJP ranks during Union Home
Minister Amit Shah’s January
31 rally in Howrah, another
Bengal Minister Rajib Banerjee
on Friday put in his papers
holding out some “emotional
details” before the media
moments after tendering his
resignation to Governor
Jagdeep Dhankhar.
Rajib is the third Minister
to resign from the Mamata
Banerjee Government in a
month after Suvendu Adhikari
and Laxmi Ratan Shukla.
An hour later, Chief
Minister Mamata Banerjee
reportedly “removed” the
Forest Minister from his posi-
tion because there were some
procedural lapses on his part in
tendering his resignation.
Sources at State Secretariat
Nabanna said that he was being
removed as he had tendered his
resignation to the Governor
instead of the Chief Minister
who was his official appointee
as the leader of the Cabinet.
While the Trinamool
Congress leadership promptly
responded to the latest resig-
nation drama saying a bucket
of water taken out of the ocean
would not matter much,
besides raising some feeble
corruption charges against the
“just former” Minister who
was yet to quit the party, Rajib
said he had made up his mind
to resign more than two years
ago after the Chief Minister
removed him unceremonious-
ly as the Irrigation
Minister.
“Most regretfully I inform
you that I have tendered my
resignation from my office as
Cabinet Minister being in
charge of Forest Department,”
an emotional Rajib Banerjee
said.
$QRWKHU0LQLVWHU
TXLWV'LGL*RYW
OLNHOWRMRLQ%-3
?C8Q =4F34;78
Popular “bhajan” singer
Narendra Chanchal, best
known for his songs “Chalo
bulawa aaya hai” and “Tune
mujhe bulaya sherawaliye”, died
following prolonged illness at
a hospital here on Friday,
sources in the hospital said.
Chanchal, 76, breathed his
last at 12:15 pm at the Apollo
Hospital after suffering from
brain complications, the
sources said.
The singer, who is survived
by his wife Namrata, had been
admitted to the south Delhi
hospital on November 27, they
said.
Born to a Punjabi family in
Namak Mandi, Amritsar,
Chanchal’s growing up years in
a religious atmosphere inspired
him to start singing “bhajans”
and “aartis” (devotional songs)
from a very young age.
In Hindi cinema, he found
fame with the song “Beshak
Mandir Masjid” for the 1973
film “Bobby”, the blockbuster
debut of Rishi Kapoor and
Dimple Kapadia. He won the
Filmfare Best Male Playback
Award in 1974 for the
song.
One of his most popular
tracks was “Chalo Bulawa Aaya
Hain Mata Ne Bulaya Hain”
from Rajesh Khanna’s 1983
drama “Avtaar”.
µ4YR]`Sf]RhRRRjR
YRZ¶dZ_XVc?RcV_UcR
4YR_TYR]_`^`cV Noida (UP): Noida Police on
Friday claimed to have busted
an illegal kidney transplanta-
tion racket involving foreigners
and Indian citizens with the
arrest of two persons, includ-
ing a Bangladeshi citizen.
The Bangladeshi national
was allegedly being forced to
donate his kidney and an
Indian person had facilitated
his travel and stay in the coun-
try, the police said.
An FIR was lodged against
five persons at the Phase 3
police station following a com-
plaint by the Gautam Buddh
Nagar district health depart-
ment, Deputy Commissioner
of Police, Central Noida, Harish
Chander said.
“Some people were
brought in from Bangladesh in
exchange for financial benefits
but were involved in kidney
transplants. Two people have
been arrested in connection
with the racket,” Chander said.
“We are investigating in
detail how these foreigners
were brought into the country
and who else is involved in this
racket. We are also verifying in
detail the documents provided
by these people,” the officer
said.
Those held have been iden-
tified as Bangladeshi citizen
Ahmed Sharif and Bazulhaq, a
native of Siwan district in Bihar
and currently living in Delhi’s
Shaheen Bagh, police said.
The others booked in the
case included a man who was
supposed to be getting the
kidney harvested illegally from
Sharif, a Bangladeshi travel
agent Abdul Mannan, and one
more person, they said.
The FIR has been lodged
under Indian Penal Code sec-
tions 420 (cheating), 468 and
471 (all related to forgery of
documents) besides the
Foreigners Act, 1984, and the
Transplantation of Human
Organs and Tissues Act, 1994,
police added. PTI
:XS]ThcaP]b_[P]cPcX^]aPRZTc
QdbcTSX]=^XSP1P]V[PSTbWX
]PcX^]P[P^]V!PaaTbcTS
6RQLDWRVFKHGXOH
HOHFWLRQWRZRUNLQJ
FRPPLWWHHDOVR
/CWT3PX[h?X^]TTa UPRTQ^^ZR^SPX[h_X^]TTa
7`]]`hfd`_+
fffSPX[h_X^]TTaR^
X]bcPVaPR^SPX[h_X^]TTa
;PcT2Xch E^[ $8bbdT !!
0XaBdaRWPaVT4gcaPXU0__[XRPQ[T
?dQ[XbWTS5a^
34;78;D2:=F 17?0;17D10=4BF0A
A0=278A08?DA 270=3860A7
347A03D= 7H34A0103E890HF030
4bcPQ[XbWTS '%#
51,1R5HJQ877(1*5(*'1R8$'2''1
347A03D=B0CDA30H90=D0AH !!! *?064B !C!
@A:?:@?'
8=CAD?
C74HCADBC
H@C=5)
:00;070AA8B0BE824?A4B834=C5DAC74A
244=CBDB8=380A4;0C8=B78?)F7
m
DA@CE#
;8E4A?;;B4
0C0=584;3
9=@?BD1D
D?B19C5
F?935*415B
! F9F139DI
m
]PcX^]!
347A03D=kB0CDA30H k90=D0AH !!!
3ULQWHGDQGSXEOLVKHGEKDQGDQ0LWUDIRUDQGRQEHKDOIRI0.3ULQWHFK/WG1R%HKLQG*XODE%KDZDQ %DKDGXU6KDK=DIDU0DUJ1HZ'HOKL 3KRQHRPPXQLFDWLRQ2IILFH)6HFWRU12,'$*DXWDP%XGK1DJDU83
3KRQH	 DQGSULQWHGDW-DJUDQ3UDNDVKDQ/WG
'6HFWRU1RLGD83
(GLWRUKDQGDQ0LWUD$,5685+$5*(RIC (DVWDOFXWWD1RUWK/HK:HVW0XPEDL	$KPHGDEDG6RXWK%DQJDORUH	KHQQDLHQWUDO.KDMXUDKR/XFNQRZ2IILFHWK)ORRU6DKDUD6KRSSLQJHQWUH)DL]DEDG5RDG/XFNQRZ7HOHSKRQHV
$OWKRXJKHYHUSRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHOIRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULWRIRUELQGLQJLQDQZDRQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQUHVSRQVLELOLWIRUDQ
GDPDJHRUORVVWRDQSHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQDFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULIDQGVHHNDSSURSULDWHDGYLFHWRVDWLVIWKHPVHOYHVDERXWWKHYHUDFLWRIDQNLQGRIDGYHUWLVHPHQWEHIRUH
UHVSRQGLQJWRDQFRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQHPSORHHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQNLQGRIFODLPPDGHEWKHDGYHUWLVHUVRIWKHSURGXFWV	VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQNLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV
BC055A4?AC4AQ =4F34;78
At least 266 fresh cases of
Covid-19 reported in the
national Capital on Friday
while the daily positivity rate
stayed at 0.37 per cent.
According to the health
bulletin issued by the Delhi
Government, the total number
of people infected with life-
threatening COVID-19 has
reached 633542. With this, the
death toll rose to 10789 with
seven new fatalities reported on
Friday.
The number of cases and
the single-day fatality count
now indicate a marked
improvement in the situation
since the third wave of the pan-
demic had hit the city in
November
The highest single-day
spike 8,593 cases till date was
reported on November 11. The
situation in Delhi has improved
in the last several days, with a
low number of cases and reduc-
tion in death count,
Besides fall in active cases,
the count of home isolation
cases have also registered a sus-
tained fall, dropping to below
825-mark, indicating improve-
ment in the COVID-19 situa-
tion, as per the bulletin.
These 266 new cases came
out of the 71850 tests con-
ducted the previous day,
including 43105 RT-PCR tests
and 28745 rapid antigen tests.
According to the Tuesday bul-
letin issued by the Delhi health
department, out of the total
number of 9068 beds in
COVID hospitals, 8125 are
vacant.
It said that 125 beds in
COVID care centres are occu-
pied by persons under quar-
antine, including travellers who
have returned by the Vande
Bharat Mission and bubble
flights.
BC055A4?AC4AQ =4F34;78
TheEconomicOffencesWing
(EOW) of Delhi Police has
arrested two men who con-
vincedpeopletoinvestmoneyin
their upcoming project in
Bahadurgarh,Haryanabutfailed
to allot the land to the victims.
The accused persons iden-
tified as Vijender Singh (52)
and his associate Dalip Kumar
(46), were arrested by the
Economic Offences Wing of the
Delhi Police on Thursday.
Police said that Singh, a
retired Indian Air Force
employee started working as a
property dealer along with
Kumar who was already in the
real estate business. According
to Dr O P Mishra, the Joint
Commissioner of Police, EOW,
in 2015, the accused invited
people to invest in an upcom-
ing project Ganga City Colony
through their firm Ganga
Associates based in Dwarka.
“After taking the amount
from victims, neither did they
hand over the possession of
booked plots nor return the
amount to the victims. The
other directors in the company
-- Ajay Kumar and Hemraj --
have already been arrested ear-
lierinthecase,”saidtheJointCP.
“The complainants alleged
that the directors of Ganga
Associates offered to sell plots
in their upcoming project at
Gubhana Kheri and assured
them that all necessary
approvals had been obtained
from the authorities. Believing
them, 24 people paid approxi-
mately Rs 50 lakhs to the
accused,” said the Joint CP.
“Later, it emerged that the
accused had not obtained the
approvals for the project. A case
was registered against the direc-
tors of the company in 2018 and
investigation was taken up by
the EOW,” he said.
“Investigationsrevealedthat
SinghandKumarinconnivance
with other directors lured peo-
ple to invest money in their pro-
ject, assuring allotment of plot
but they failed to do so. It was
also revealed that they did not
have any land for the project at
Gubhana Kheri. They had no
permission from the District
Town Planner to develop the
project and had concealed the
factthatthelandinquestionwas
cultivableland,”saidtheJointCP.
BC055A4?AC4AQ =4F34;78
The Delhi Police on Friday
inducted 50 volunteers who
will be its eyes and ears at the
busy Sarojini Nagar market
area to tackle terror threats
ahead of Republic Day cele-
bration in the National Capital.
According to Ingit Pratap
Singh, the Deputy
Commissioner of Police
(DCP), Southwest district, the
volunteers in the police service
programme are mostly shop-
keepers and workers at the
Sarojini Nagar market and will
keep an eye on any suspicious
activity.
“In the eventuality of a ter-
ror attack, the group would help
other shopkeepers in evacuat-
ing the market place. The vol-
unteers know the corners of the
market well and are familiar
with the entry and exit points.
They are also responsible for
looking after the security dur-
ing festivals, said the DCP.
“The volunteers would be
provided a jacket and a badge
which would make it easy for
the police to identify them
during an emergency situation,”
said the DCP.
Sarojini Nagar is one of the
most vulnerable places. There
was a bomb blast there in
2005. The volunteers will patrol
the market during peak hours
with staff of Sarojini Nagar
police station and will help in
preventing pick-pocketing, bag
lifting and petty thefts in the
market.
“They will keep a watch
over the suspicious activities
and will enhance a sense of
security amongst the customers
visiting the Sarojini Nagar
Market. The antecedents of
the volunteers were checked
thoroughly before they were
allowed to join the team,” the
DCP added.
BC055A4?AC4AQ =4F34;78
Delhi Chief Minister Arvind
Kejriwal on Friday direct-
ed the officials of Delhi State
Industrial and Infrastructure
Development Corporation Ltd
(DSIIDC) to conclude all the
developmental works in indus-
trial areas including the first-of-
its-kind business park in a
time-bound manner.
The direction came in a
meeting convened by the Chief
Minister with the officials of
DSIIDC to review the devel-
opment work on the new Rani
Khera Technology Park, a new
IT business park to be con-
structed in Delhi. The DSIIDC
officials gave a presentation to
the chief minister on the con-
struction work, which will
commence from May 2021
onwards.
The entire construction of
the project should be complet-
ed within the stipulated time-
line. It should be done in a
time-bound manner,” he said.
Kejriwal also reviewed the
status of the on-going mainte-
nance works in the industrial
areas of DSIIDC. The new
deadlines of the on-going
maintenance works have been
set up by the departments due
to the outbreak of COVID-19.
Kejriwal directed the officials to
complete the pending and on-
going redevelopment and
maintenance works in DSI-
IDC industrial areas as per
revised deadlines.
Kejriwal also reviewed the
status of the on-going mainte-
nance works in the industrial
areas of DSIIDC. Delhi
Minister of Industries
Satyendar Jain and other senior
officials were also present in the
meeting.
In the meeting chaired by
Kejriwal, the officials of the
DSIIDC presented the detailed
plan for the construction of the
business park. The Delhi gov-
ernment will develop this first-
of-its-kind business park in
seven different phases. The
first phase of the Rani Khera
Business Park development
project is expected to be com-
pleted by May 2023 and the
second phase of the project is
expected to be completed by
May 2025.
The chief minister was also
apprised that all necessary
approvals of the concerned
government departments have
been duly completed.
4`^a]VeVR]]T`_decfTeZ`_h`cdZ_Z_UfdecZR]RcVRd+V[cZhR]
$c^bTaeTPb³ThTbTPab´^U_^[XRTPc
BPa^YX]X=PVPaZcPWTPS^UA3Ph
'HOKLUHSRUWV
IUHVKRYLGFDVHV
Dg_`b_`UbdiTUQUbc
XUTV_bTe`Y^W`U_`U
CWTR^_[PX]P]cbP[[TVTS
cWPccWTSXaTRc^ab^U6P]VP
0bb^RXPcTb^UUTaTSc^bT[[
_[^cbX]cWTXad_R^X]V
_a^YTRcPc6dQWP]P:WTaX
P]SPbbdaTScWTcWPcP[[
]TRTbbPahP__a^eP[bWPS
QTT]^QcPX]TSUa^cWT
PdcW^aXcXTb1T[XTeX]V
cWT!#_T^_[T_PXS
P__a^gXPcT[hC$[PZWb
c^cWTPRRdbTS
BC055A4?AC4AQ 6DAD6A0
Acrime unit of the Gurugram Police
have arrested four inter-State want-
ed criminals who had looted Rs 10 lakh
at gunpoint from a company employ-
ee in Gurugram on January 11, the
police said on Friday.
The arrested accused were involved
in three cases of loot and dacoity
which they had committed in
Gurugram and Delhi. The police have
also recovered 2 motorcycles which
were used in the crime.
The culprits were identified as
Shrawan alias Sikender (34) of Hisar,
Sandeep (28), Suresh alias Bittu (38) and
Surender alias Sonu (35) all residents
of Jhajjar.
The accused were arrested by the
crime branch unit Sector-17 led by
Inspector Narender Chauhan from
Sector-14 on Thursday after a tip-off.
During interrogation the accused
revealed that they used to stand outside
the bank and keep vigil on people who
came outside alone with bag later they
followed them on their bike and robbed
them on gun point. As of now the
accused have robbed Rs 28 lakh in three
instances, said Preet Pal Sangwan, ACP
(crime). On January 11, Deepak Pandey,
who was working with a private firm
located in Udyog Vihar Phase- 1 was
robbed at Atul Kataria chowk by the
three arrested criminals on gun point.
Panday had withdrawn Rs 10 lakh
from a private bank located in sector-
14 and was going to his company on his
scooty when the incident took place.
An FIR under relevant sections of
the IPC had been lodged against three
unidentified robbers at the Palam
Vihar police station.
BC055A4?AC4AQ =4F34;78
Following the directions from a court, the
Delhi Police has registered a cheating case
against Shiromani Akali Dal leader and Delhi
Sikh Gurdwara Management Committee
(DSGMC) president Manjinder Singh Sirsa.
In November last year, a Delhi court had
directed the Economic Offences Wing (EOW)
of Delhi Police to register an First Information
Report (FIR) against Sirsa for alleged misap-
propriation of funds during his tenure as the
secretary general of the DSGMC. According to
a senior police official, the case against Sirsa and
others was registered on Thursday for cheat-
ing and embezzlement of gurdwara funds by
making huge unjustified payments, totalling
around Rs 1 crore, for the purchase of tents,
blankets and tarpaulin from sham companies.
“It was registered on the basis of a com-
plaint by one Bhupinder Singh, who is one of
the stakeholders in the funds received by the
DSGMC,” said the senior police official.
2WTPcX]VRPbTPVPX]bc
6daSfPaP2^XccTT
_aTbXST]cBXabP
#RaXX]P[bfW^a^QQTSC ;
PcVd]_^X]cX]6³VaPWT[S
CWT_^[XRTWPeTP[b^aTR^eTaTS!
^c^aRhR[TbfWXRWfTaT
dbTSX]cWTRaXT
?=BQ 347A03D=
SIIDCUL Entrepreneur
Welfare Society Pantnagar
organised road safety month at
SIIDCUL fire station in Udham
Singh Nagar district.
Representatives of almost
all the industries participated in
the programme. ARTO Vipin
Kumar gave a detailed lecture
on road safety. He said the traf-
fic rules and guidelines are
made for the benefit and safe-
ty of common citizens.
SIIDCUL Association’s
President Manoj Tyagi dis-
closed that series of pro-
grammes linked to road safety
will be organised throughout
the month. He said there was
nothing precious then life
asserting that a large number of
lives are lost every year in
road mishaps. Fire services
officer Udham Singh Nagar
Vansh Yadav informed the
gathering about the impor-
tance of safety in one’s life. He
said strictly adhering to safety
rules helps one save himself
from road accidents.
5RDG6DIHW0RQWK
DW6,,'8/
NEW DELHI: All 12 samples
of dead cranes in the Delhi zoo
have tested negative for bird flu,
authorities said on Friday, a
week after the first case of avian
influenza was detected in its
premises.
“Four cranes were found
dead in the Delhi zoo a few
days ago. Twelve samples were
collected on Monday and sent
to National Institute of High
Security Animal Diseases
(NIHSAD) of Indian Council
of Agricultural Research for
testing, Bhopal,” Dr. Rakesh
Singh, the director of the ani-
mal husbandry unit of the
Delhi government, said.
All the 12 samples have
tested negative, he said.
Last week, samples from a
dead owl in the Delhi zoo had
tested positive for avian
influenza.
Zoo Director Ramesh
Pandey said they were follow-
ing all protocols and monitor-
ing the situation strictly.
We have been using the
ebird mobile application to
keep track of the birds in the
premises of the zoo, he said.
This is the first time the
application is being used for
bird monitoring and record
keeping during the outbreak of
avian influenza.
The application allows the
user to enter sightings from
anywhere in the world, even in
areas with no cell service, or
Internet access. Singh said that
1,338 bird deaths have been
reported in Delhi between
January 6 and January 21 amid
the bird flu situation.
BP_[Tb^USTPSRaP]TbX]3T[WXi^^cTbceTU^aQXaSU[d
Gurugram: Two men includ-
ing a juvenile have been
detained for the murder of a
65-year-old woman in
Gurugram's Sohna area, the
police said, adding that the
crime reportedly took place on
Friday morning.
According to the police, the
investigation team have
detained the culprits involved
in the crime and are question-
ing them. Names of the accused
will be disclosed after detailed
investigation.
Police said the victim's
body, which was lying on the
floor, was first noticed by her
domestic help inside her house
at Kayastha wada colony of
Sohna in Gurugram on Friday
morning at around 5 a.m. Her
head had been slashed brutal-
ly with some blunt object and
her entire house was
ransacked. IANS
Y^SeTY^WZefU^YU
TUdQY^UTV_b[YY^W
UTUbig_]Q^
RP_XcP[
347A03D=kB0CDA30H k90=D0AH !!!
?=BQ 347A03D=
Considering the situations
caused by Covid-19 and to
expedite the remaining works
for the Kumbh Mela 2021 in
Haridwar, the State Cabinet has
approved four decisions in its
meeting held on Friday.
Informing the media about
these decisions, Cabinet
Minister and State Government
spokesman Madan Kaushik
said that the decision taken by
the Chief Minister Trivendra
Singh Rawat to authorise the
Kumbh Mela officer and
Garhwal commissioner to
approve works costing upto Rs
two crore and Rs five crore
respectively was approved by
the cabinet. The cabinet also
decided to grant the Kumbh
Mela officer the authority to
increase approved works by 50
per cent. In addition to this, the
cabinet also granted its
approval to make the tender
process period seven days and
to split work projects in two
parts.
Kaushik informed that a
total of 15 decisions were taken
by the cabinet in its meeting.
He informed that there are 155
teachers in the Sanskrit
Education department teaching
at various levels from school to
college. For teachers in man-
agerial positions and who have
been teaching continuously for
five years the cabinet approved
Rs 15,000 per month, Rs 25,000
per month for teachers who
have been teaching for five to
10 years and Rs 30,000 per
month for teachers who have
been teaching for more than 10
years. Further, according to
University Grants Commission
standards, any of these teach-
ers who have done MPhil or
PHd will be paid an addition-
al Rs 5,000 allowance. The
cabinet also approved 0.206
hectare land at Ranikhet in
Chaukhutia block of Almora
district for establishing a
Kendriya Vidyalaya. Kaushik
further informed that 22,492
pre-matric scheduled caste stu-
dents got less scholarship
amount during 2017-18 and
2018-19 as the funds were not
received. The cabinet approved
Rs 3.79 crore from the State
budget to pay the remaining
scholarship amount to these
students. Similarly, a sum of Rs
4.36 crore was approved to pay
the remaining scholarship
amount to about 20,000 other
backward classes students. The
cabinet also approved the cre-
ation of six technical posts in
the engineering wing of the
Uttarakhand Tourism
Development Board. The
Uttarakhand drug control ser-
vice manual was also promul-
gated.
The minister further
informed that from the list of
21 organisations working as
executing agencies for various
state government departments,
the cabinet approved the
removal of Uttar Pradesh
Rajkiya Nirman Nigam and the
Uttar Pradesh Samaj Kalyan
Nirman Nigam. Further, the
work capacity of the Rural
Engineering Services has been
increased from Rs five crore to
Rs 15 crore. In another deci-
sion, the cabinet gave its
approval to the firm CAMP to
operate 132 of the 140 ambu-
lances handed over to the state
during the Covid pandemic.
The operation of the ambu-
lances which will also be used
during the Kumbh Mela was
handed over as per the 2018
rates. In addition to this, the
cabinet also approved alloca-
tion of 4.384 hectare land of the
irrigation department in
Haridwar to facilitate Bhu
Samadhi for deceased mem-
bers of the religious
fraternity.
4RSZ_Ve_`Ue`UVTZdZ`_de`ViaVUZeV
cV^RZ_Z_Xf^SYV]Rh`cd
?=BQ 347A03D=
The Covid-19 contagion is
fast diminishing from the
state of Uttarakhand. The new
cases of the disease are now
concentrated in the three dis-
tricts of Dehradun, Haridwar
and Nainital. On Friday ten out
of 13 districts of the state
reported less than five new
cases of the disease. Three dis-
tricts reported no case on the
day. Meanwhile the number of
novel Coronavirus (Covid-19)
cases in Uttarakhand increased
to 95464 on Friday with the
state health department 110
new cases of the disease.
The department also
reported the death of three
patients on Friday which
increased the death tally to
1629 in the state. The health
authorities discharged 183
patients from different hospi-
tals of the state following their
recovery on the day. A total of
90730 patients have so far
recovered from the disease.
The recovery percentage in
the state now stands at 94.04
and the sample positivity rate
is 4.67 percent.
Two patients of the disease
were reported dead at Sushila
Tiwari government hospital
Haldwani on the Friday while
one patient succumbed to the
disease at Government Doon
Medical College (GDMC) hos-
pital. Out of 183 patients
recovered on the day, 72 were
from Dehradun while 48 were
from Nainital.
The state health depart-
ment reported 54 new patients
of the disease from Dehradun,
29 from Nainital, 13 from
Haridwar, four from Udham
Singh Nagar, three from
Rudraprayag, two each from
Champawat and Pithoragarh,
one each from Chamoli,
Bageshwar and Tehri districts.
No new patient of Covid-19
was detected in Almora, Pauri
and Uttarkashi districts on the
day.
Uttarakhand now has 1795
active cases of the disease.
Dehradun is at continuing to
remain at top of the table of
active cases with 424 cases
while with 311 active cases
Nainital is at second spot.
Haridwar is at third position
with 245 cases, Almora has 133,
Bageshwar 129, Udham Singh
Nagar 125, Chamoli 88, Tehri
87, Pithoragarh 82, Uttarkashi
75, Pauri 55 and Rudraprayag
36 active cases of the disease.
With only five active cases of
Covid-19, Champawat is at
the bottom of the table.
?=BQ 347A03D=
Notwithstanding the decline
in enthusiasm among the
health workers, the vaccination
drive in the state is continuing
with planned regularity. On
Friday a total of 2308 health
workers were vaccinated in 35
vaccine sessions held in all the
13 districts of the state. The
chief operations officer (COO)
of the state Covid-19 control
room, Dr Abhishek Tripathi
said that 171 vaccine sessions
have so far been held in the state
and in them 10514 health work-
ers have received the first dose
of the vaccine. On Friday five
vaccine sessions were held in
Dehradun district and in them
440 workers were vaccinated. In
Udham Singh Nagar 241 health
workers received the jab of the
vaccine in four vaccine sessions.
In Almora 118 workers were
vaccinated on the day. Similarly
96 health workers in Bageshwar,
183 in Chamoli, 165 in
Champawat, 190 in Haridwar,
230 in Nainital, 125 in Pauri,
100 in Pithoragarh, 155 in
Rudraprayag, 143 in Tehri and
122 in Uttarkashi were vacci-
nated on the day.
The second dose of the
vaccine would be adminis-
tered to these recipients on
28th day of the first dose. The
health department has direct-
ed the Chief Medical Officers
(CMO) to ensure that the sec-
ond dose of vaccine is kept safe
for the beneficiaries. The state
has so far received two con-
signments of the Covishield
vaccines. In the first lot, 113000
doses were sent to the state
while in the second 92500
doses were received. The
Covishield vaccine is developed
by Oxford University-
AstraZeneca and manufac-
tured in India by Serum
Institute of India (SII).
?=BQ 347A03D=
Aworkshop titled 'Pressure
Injury Evidence Based
Nursing Approach' was orga-
nized by the Department of
Nursing Services in All India
Institute of Medical Sciences
(AIIMS) Rishikesh on Friday.
In the workshop, the partici-
pants were given detailed infor-
mation about the immediate
identification, prevention and
treatment of pressure injury.
Addressing the workshop
the Director of AIIMS
Rishikesh Ravi Kant, said that
the institute strives to bring
international level of efficien-
cy in pressure engineering
management. He said that after
taking experience from AIIMS
Rishikesh, nurses will provide
better nursing services not
only in the country but also out
of the country.
The Dean Academics of
the institute, Professor Manoj
Gupta said that nursing staff
have an important role in pres-
sure injury management and
treatment in the hospital.
Professor UB Mishra informed
the participants about the his-
tory of pressure injury. Giving
various examples, he gave
information about the changes
coming in this direction. In the
workshop Dr Rajalakshmi Iyer
gave information about the
pressure injury overview while
Dr Madhubari Vathulya of the
Department of Burn and
Plastic Surgery, spoke about the
grade classification of pres-
sure injury.
?=BQ 347A03D=
Uttarakhand chief minister
Trivendra Singh Rawat
inaugurated the state's first
child-friendly police station
unit in the premises of
Dalanwala police station in
Dehradun on Friday.
Addressing the gathering,
Chief minister stated that this
initiative will provide friendly
and unintimidating environ-
ment to children who are either
victims or involved in the juve-
nile delinquency. Rawat assert-
ed that children should be
introduced to police as their
friends and protectors rather
than someone they should be
scared off. Moreover, CM also
announced to set up a revolv-
ing fund of Rs one crore on the
request of the SCPCR chief
Usha Negi for child protection
and welfare programmes across
the State.
Earlier, Usha Negi from
State Commission for
Protection of Child Rights
(SCPCR) also stated that con-
sidering the hike in juvenile
crimes in recent years, the
establishment of child-friend-
ly police station will help chil-
dren to have an open interac-
tion with authorities without
being intimidated. As the next
step in this initiative, all the dis-
tricts will have their own child-
friendly police station which
will be established with the help
of the police department. For
the establishment of child-
friendly police stations in 13
districts of the State, the child
commission will issue Rs 13
lakh to the police department
soon, informed Negi.
Meanwhile, the director-
general of police (DGP) Ashok
Kumar said that the police
always make efforts to make
every police station child and
woman friendly. Moreover,
Kumar said that about 2200
child beggars were marked
under operation Mukti and
now most of these children are
getting school education. He
asserted that people should
support children, especially
child beggars by taking their
responsibility and directing
them towards education to
make them independent rather
than giving them some money
which does no good to them in
the long run. Moreover, mayor
Sunil Uniyal 'Gama', Rajpur
MLA, Khajan Das, DIG
Garhwal Neetu Garg, and the
head of State Women
Commission Vijaya Barthwal
were also present in the
event.
?=BQ 347A03D=
Aviral video in which two
persons said to be the for-
mer employees of Khanpur
MLA, Kunwar Pranav Singh
Champion are seen accusing the
MLA for threatening them has
given a chance to the opposition
Congress party to attack the
government. The spokesper-
son of Uttarakhand Congress
and member of All India
Congress Committee (AICC),
Garima Dasauni said on Friday
that the allegations levelled
against the BJP MLA in the
video are shocking and put up
a question mark over the state
police which is keeping quiet on
the issue. She said that the
silence of the chief minister and
the government on the issue
shows that the BJP is protecting
its MLA. Terming Champion as
synonym of controversies, the
Congress leader said that prima
facie the allegation levelled by
the former employees of the
MLA are of serious nature and
the police and state adminis-
tration should take immediate
note of the issue.
?0A8CB7:8C78
As some experts have been
stating openly for some
years now, information and the
manner in which it is used is
the most powerful tool to influ-
ence minds and actions of the
people. One could even argue
that information is more pow-
erful than even the most
destructive conventional
weapons as the decision to use
such weapons is based on
information. Though many
nations cannot drop out of the
race to enhance their armed
forces further, most have devel-
oped their own ways to capi-
talise on the power of infor-
mation and the effect of disin-
formation.
Conspiracy theories are
one phenomenon that appear
to have grown in influence in
recent years. A conspiracy the-
ory is considered to be a theo-
ry that explains a set of cir-
cumstances or an event as
something brought about by a
secret plot usually by powerful
conspirators. They range from
fantastic sounding ideas like
‘lizard people’ living among us
and controlling politics to one
of the comparatively recent
theory –QAnon which basi-
cally centered around the idea
of the previous US president
Donald Trump waging a secret
battle versus elite Satanist pae-
dophiles in government, busi-
ness and the media. Not all
conspiracy theories are untrue
like the one about the CIA con-
ducting mind control experi-
ments on unaware citizens
during the 1950s and 60s which
was later found to be correct.
However, whereas some con-
spiracy theories may bring
about negligible changes in
the people who believe in
them, others may have a more
serious impact. The followers
of QAnon were among those
leading the recent storming of
the Capitol Hill in the USA
apart from being involved in
disturbances which also saw
followers of other such fuelled
agitations. The influence such
ideas have can be gauged from
the fact that they have follow-
ers in various countries includ-
ing India. Such theories have
created a global fraternity of
people who also believe that the
latest viral pandemic is a con-
spiracy too. A neuroscientist or
psychiatrist can explain aspects
like the tendency to view pat-
terns where none exist, the nat-
urally higher levels of
dopamine and the proclivity for
confirmation bias in people
who tend to be strong believ-
ers even in unfounded con-
spiracy theories. Some con-
spiracy theorists cleverly mix
credible facts with illogical fac-
toids, which makes one wonder
whether such theories are per-
petuated by people actually
wanting to conceal the uncom-
fortable facts by mixing them
with fantastic contents to dis-
credit the whole mixture.
Whatever the case be, the real-
ity being faced regularly is the
repercussions of disinforma-
tion and calculated moves
influencing people in ways
that are not really desirable.
Take the example of the agita-
tion being carried out against
the farm laws. If one digs even
a bit without bias into the
issue, the past and ideological
evidence related to some of
2^eXSePRRX]PcX^]
KHDOWKZRUNHUV
YDFFLQDWHGRQ)ULGD
0c^cP[^U  ePRRX]T
bTbbX^]bWPeTb^UPaWT[SX]
cWTbcPcTP]SX]cWT $ #
WTP[cWf^aZTabWPeTaTRTXeTS
UXabcS^bT^U2^eXbWXT[S
3_fYTSQcUcTUSbUQcY^W
bQ`YTiY^EddQbQ[XQ^T

 CWaTTSTPcWb
]Tf_PcXT]cb
aT_^acTS^]5aXSPh

 =^_PcXT]c
STcTRcTSX]
0[^aP?PdaXP]S
DccPaZPbWXSXbcaXRcb
C74C74AB834
2IFRQVSLUDFWKHRULHVDQGPRGLILHGIDFWRLGV
F^aZbW^_^]
_aTbbdaTX]Ydah
WT[SPc088BA
8]cWTeXaP[eXST^
cf^Qa^cWTabQ[PT
:WP]_da;0U^a
cWaTPcT]X]VcWT
?=BQ 347A03D=
Even after the instructions of
the Municipal Corporation
of Dehradun (MCD) to provide
the list of those who do not dis-
pose of domestic garbage
through the door to door
garbage collection service, the
Ramky Enviro Engineers
Limited (REEL) has failed to
provide the list for over two
months. Despite the door to
door service provided by the
corporation in most of the
wards, the domestic garbage is
mostly found dumped on road-
side areas of the city. Taking
strict action against the issue,
MCDaskedREELthatmanages
the sanitation facility in 69
wards to provide the list of
those households which do not
dispose of garbage in these
wards. The senior municipal
health officer Dr R K Singh had
stated that they would issue
notices to such households and
impose penalties under anti-lit-
tering act as soon as they would
receive the list. However, the
officials in MCD are still wait-
ing for the list for over two
months. Since the corporation
will start 100 percent door to
door garbage collection service
in all 100 wards from the next
month, the officials are focusing
to improve the service in the old
wards too, especially due to
Swachh Survekshan 2021.
Talking about this, the chief
municipal health officer Dr
Kailash Joshi said that the cor-
porationhadaskedREELtopre-
pare the list of all such house-
holds that do not dump garbage
in the door to door collection
service but the corporation has
received no list so far. He said
that MCD has sent a notice to
thecompanyregardingthedelay
andhasinstructedtoprovidethe
list as soon as possible.
23PbZbA44;c^_a^eXST[Xbc
^UW^dbTW^[SbcWPcUPX[c^Sd_
VPaQPVTX]S^^ac^S^^abTaeXRT
?=BQ 347A03D=
The troupe representing
Uttarakhandpresentedacul-
tural performance in traditional
attire as part of the Rashtriya
Rangshala Camp organised by
theDefenceministryaheadofthe
RepublicDaycelebrationinNew
Delhi. The troupe from
Uttarakhand was among the
representatives from 17 states
who performed along with the
tableaux of their states.
It is worth mentioning here
that headed by the State infor-
mationdepartmentdeputydirec-
tor KS Chauhan, a 12-member
troupe is performing as part of
Uttarakhand’s tableau in the
Republic Day parade in the
nationalcapital.Thethemeofthe
state’s tableau is Kedarkhand.
Modelsofthestateanimal-musk
deer, state bird Monal pheasant
and the state flower
Brahmakamal have been dis-
playedonthefrontofthetableau.
Themiddleportionofthetableau
displays a model of the sacred
bull Nandi facing a model of the
Kedarnathtemple.Pilgrimshave
also been shown going towards
Kedarnath in the tableau.
D´ZWP]ScPQ[TPdT[XRXcb_aPXbT
X]APbWcaXhPAP]VbWP[P2P_
?=BQ 347A03D=
Deepak Joshi was re-elected
on the prestigious position
of the President of the
Uttarakhand secretariat asso-
ciation on Friday. In a keenly
contested election, he defeated
his nearest rival Narendra
Prasad Raturi by nine votes.
Joshi received 492 votes while
Raturi got 483. Third contes-
tant Balwant Singh Jyada was
able to receive only 27 votes.
Vimal Joshi was elected secre-
tary in the election. He got 317
votes while Rakesh Chandra
Joshi and Pradip Papne got 279
and 225 votes respectively. In
these elections, Sunil Kumar
Lakhera won the post of vice
president of the association.
The term of the new executive
body would be two years.
9^bWXaTT[TRcTS
_aTbXST]c^U
bTRaTcPaXPcQ^Sh
3TUTPcb=?
APcdaXX]P
R[^bTR^]cTbc
8]eTbcXVPcT2WP_X^]beXST^)2^]VaTbbc^6^ec
those leading the movement, a
person’s opinion will surely be
affected. Of course, one can
also find things to criticise
about the government, other
politicians and tycoons but
some rich people pretending to
be poor and directing others to
oppose some other rich people
for making money is highly
questionable to say the least.
Whether one likes it or not, it
is a common human tendency
to blame other people or forces
beyond our control for our own
problems. However,
when such blame is
illogical, it will not
lead to anything fruit-
ful. The government
is doing its bit to tack-
le this, at times suc-
cessfully, sometimes
with delayed results
and sometimes
unsuccessfully. What
remains to be seen is
whether we also
become alert and go
beyond conspiracy
theories and modified
factoids.
2bTcbd_aTe^[eX]VUd]SU^aRWX[S_a^cTRcX^]P]SfT[UPaT
?=BQ 347A03D=
Action will be taken to
resolve the issues being
faced by the Tehri dam dis-
placed persons within two
months. This decision was
taken in the meeting of Union
Minister of State for Power,
Rajkumar Singh with the del-
egation from Uttarakhand led
by the state’s Irrigation Minister
Satpal Maharaj in New Delhi
on Friday.
It was decided in the meet-
ing that the 415 Tehri dam dis-
placed families not yet reha-
bilitated will be provided land
or fund. Agreement was
reached on most issues and it
was decided that the problems
will be resolved in two months.
The government of India
power secretary and
Uttarakhand irrigation secre-
tary have been directed for val-
uation of the land of the dis-
placed. Putting to rest specu-
lation about shifting of the
headquarters of THDC India
Limited, Singh said that the
headquarters will remain in
Rishikesh. It was also decided
that a policy will be prepared
for periodic transfer and pro-
motion of the THDCIL staff.
Further, a committee will be
formed soon to facilitate free
sewer and water along with
electricity at half rates for the
Tehri dam displaced. It was also
decided that seven boats and
two buses will be operated for
the Pratapnagar area affected
by the dam. It was also decid-
ed in the meeting that 21
hectare land available with
THDCIL will be returned to
the eligible dam displaced. All
the court cases filed by THD-
CIL in this regard will also be
withdrawn.
Maharaj later informed
that the meeting with the
Union minister was quite fruit-
ful. Singh listened to the prob-
lems of the dam displaced seri-
ously and also spoke of resolv-
ing their issues outside the
court. The Tehri MLA Dhan
Singh Negi appreciated the
decision taken to resolve the
problems of the dam displaced
people within two months.
3UREOHPVRI7HKULGDPGLVSODFHGWR
EHVROYHGLQPRQWKV8QLRQ0LQ
]PcX^]#
347A03D=kB0CDA30H k90=D0AH !!!
?=BQ =4F34;78
Over 2.28 lakh healthcare
workers and frontline
workers received the Covid-19
vaccine shots across the States
on Friday, the seventh day of
the mega immunisation exer-
cise that was launched on
January 16 in the country. It
took the total tally of people
who have been given the vac-
cine to 12,72,097.
“The Covid-19 vaccina-
tion programme was conduct-
ed successfully on the seventh
day of the countrywide massive
exercise. The cumulative num-
ber of healthcare workers vac-
cinated has surpassed 12.7 lakh
(12,72,097) (till 6 p.m. today)
through 24,397 sessions, as
per the provisional report,” the
Union Health Ministry said in
a statement.
A total of 267 cases of
Adverse Effect After
Vaccination (AEFI) have been
reported till 6 pm on the sev-
enth day of the vaccination
drive.
On Friday, 2,28,563 bene-
ficiaries were vaccinated till 6
p.m. through 6,230 sessions.
On Thursday, 1,92,581 people
were vaccinated and 1,12,007 a
day before.
In Karnataka, 1,82,503
have been vaccinated so far,
highest amongst all states,
followed by 1,27,726 in
Andhra Pradesh, 1,21,004 in
Odisha and 1,02,724 in
Telangana, according to the
data available from the
Government.
On the testing front too,
India continues to register
growing numbers. The cumu-
lative testing has crossed 19
Crore, said a statement from
the Union Health Ministry
with 8,00,242 samples tested
in the last 24 hours itself.
The Ministry also said
that steadily following the
trend set over the past weeks,
India’s active caseload has
fallen to 1.78% of the total
active cases. India’s active
caseload presently stands at
1,88,688.
18,002 new recoveries
were registered during the
past 24 hours. This has led to
a net decline of 3,620 cases
from the total Active Caseload
in the last 24 hours.
The total recovered cases
are 10,283,708 as on Thursday
pushing the growing gap
between the recovered and the
active cases to 1,00,95,020 (
54.5 times). The Recovery
Rate has improved to 96.78%.
Around 85 per cent of the
new recovered cases are con-
tributed by ten States/UTs
with Kerala reporting 6,229
persons recovering from the
infection. Maharashtra and
Karnataka reported 3,980 and
815 new recoveries, respec-
tively.
At least 14,545 new posi-
tive cases were registered in the
last 24 hours. Eight States/UTs
have contributed 84.14 per
cent of the new cases. Kerala
reported 6,334 cases in the last
24 hours. Maharashtra record-
ed 2,886 new cases while
Karnataka registered 674 daily
cases on Wednesday.
As many as 82.82 per cent
of the 163 case fatalities that
have been reported in the past
24 hours are from Nine
States/UTs with Maharashtra
reported the maximum new
daily deaths at 52. Kerala also
saw a fatality count of 21, as
per the statement.
@gVc#=XVedY`edd`WRc,##)=`_7cZ
?=BQ =4F34;78
Bharat Biotech has suc-
cessfully administered the
second dose of its COVID-19
vaccine Covaxin to 13,000
volunteers as part of its ongo-
ing phase-3 clinical trials of
the jab, Suchitra Ella joint
managing director of Bharat
Biotech said on Friday.
She said in a tweet,
“13,000 volunteers have been
successfully administered the
2nd dose in the phase-3 clin-
ical trials of Covaxin. My
heartfelt thanks to all of them
for their pro-vaccine public
health voluntarism.
The city-based vaccine
maker has successfully com-
pleted enrollment of25,800
volunteers for the Phase-3 tri-
als of Covaxin, Ella had ear-
lier said.
The DCGI has granted
permission for the sale or dis-
tribution of Covaxin for
restricted use in emergency
situations in public interest as
an abundant precaution, in
clinical trial mode.
The vaccine-maker in the
fact sheet on Covaxin, post-
ed in its website, had
said the clinical efficacy of the
vaccine is yet to be estab-
lished and is being studied in
Phase 3 clinical trial and
hence it is important to
appreciate that receiving the
vaccine does not mean other
precautions related to
COVID-19 need not be fol-
lowed.
Covaxin is India’s totally
indigenous COVID-19 vac-
cine developed in collabora-
tion with the Indian Council
of Medical Research and
National Institute of Virology.
The inactivated vaccine is
developed and manufactured
in Bharat Biotech’s BSL-3
(Bio-Safety Level 3) bio-con-
tainment facility, one of its
kind in the world.
:aTRTXeTbTR^]SS^bT^U
2^ePgX]X]?WPbTcaXP[b
New Delhi: The Centre on
Friday told the Supreme Court
that it was not in favour of
granting one extra opportuni-
ty to those civil services aspi-
rants who could not appear in
their last attempt in the exams
conducted by the UPSC last
year due to the COVID-19
pandemic.
A bench headed by Justice
A M Khanwilkar took note of
the submissions of Additional
Solicitor General S V Raju,
appearing on behalf of the
Department of Personnel and
Training (DoPT).
“We are not ready to give
one more chance. Give me the
time to file an affidavit... last
night I received instruction
that we are not agreeable,” Raju
told the bench, which also
comprised justices B R Gavai
and Krishna Murai.
The bench has now post-
ed the plea of a civil services
aspirant Rachna Singh for
hearing on January 25 and
asked the
Centre to file an
affidavit during
the period and
serve it to the
parties.
E a r l i e r ,
S o l i c i t o r
General Tushar
Mehta had told
the bench that the government
was considering the issue of
granting one more opportu-
nity to those civil services
aspirants who could not
appear in their last attempt to
crack the UPSC exam.
The top court, on
September 30 last year, had
refused to postpone the UPSC
civil services preliminary
exam, which was held on
October 4, because of COVID-
19 pandemic and floods in
several parts of the country.
However, it had directed
the Central Government and
the Union Public Service
Commission to consider
granting an extra chance to
candidates who otherwise
have their last attempt in 2020,
with corresponding extension
of the upper age-limit. The
bench was then told that a for-
mal decision can be taken by
the Department of Personnel
and Training (DoPT) only.
PTI
2T]caT]^cX]UPe^da^U
VXeX]VTgcaPRWP]RTc^
D?B2Pb_XaP]cbB2c^[S
?C8Q =4F34;78
The Centre has accorded
the top category ‘Z+’ VIP
security cover to former Chief
Justice of India (CJI) Ranjan
Gogoi, official sources said on
Friday.
They said Gogoi, 66, will be
protected by armed comman-
dos of the Central Reserve
Police Force (CRPF) during his
travel all across the country.
A Rajya Sabha member
now, Gogoi was earlier being
provided with a security cover
of Delhi Police
He retired in November,
2019 and was later nominated
to the upper house of
Parliament by the Government.
The CRPF has a VIP secu-
rity unit and Gogoi is its 63rd
protectee, sources said.
4G2986^V^X
VTcbIE8?
bTRdaXchR^eTa
?=BQ =4F34;78
The Enforcement
Directorate (ED) on Friday
attached assets worth C5.45
crore of Ramanand Divya, for-
mer Chief Engineer, Water
Resources Department,
Chhattisgarh and his family
members under money laun-
dering charges.
The attached assets are in
the form of agriculture land
and plots in Raipur, Bilaspur,
Korba and Janjgir-Champa dis-
tricts and bank balances to the
tune of C55.95 lakhs held by the
accused Ramanand Divya and
his family members.
The ED had initiated inves-
tigation under Prevention of
Money Laundering Act
(PMLA) on the basis of FIR
registered by ACB,
Chhattisgarh under relevant
section of Prevention of
Corruption Act which dis-
closed the disproportionate
assets to the tune of C5.45
crore amassed by Divya and his
family members.
“Investigation under
PMLA revealed that most of
the immovable properties were
purchased in the name of
Priyadarshini Divya wife of
Ramanand Divya, few being in
the name of accused
Ramanand Divya himself as
well. The properties were
acquired through various ways
of money laundering. In few
cases, property was purchased
directly in cash or through cash
deposits in bank accounts of
self as well as other relatives,”
the ED said in a statement.
In some cases, routing of
funds was done through
accounts of relatives and per-
sons with meagre sources of
income in the form of gift or
unsecured loan. For purchasing
some properties, fake sale agree-
ments of other properties show-
ing receipt in cash were also pre-
pared, to project the source of
cash as untainted, it said.
Also, there were frequent
sale and purchase of properties
to project the source of money
for purchase as genuine where-
as the very source of initial pur-
chase was unexplained and
tainted money, it further said.
Investigation further
revealed that C2.13 crore was
paid in cash for purchase of
properties.
43PccPRWTb
TgRWXTUT]VX]TTa´b
C$#$RaPbbTcb
0A270=09HC8Q=4F34;78
Raising hopes, scientists of the
School of Biochemical
Engineering of IIT-BHU in col-
laboration with the Institute of
Medical Sciences, BHU have test-
ed a vaccine that halts the progress
of the Kala Azar, a neglected trop-
ical disease caused by Leishmania
parasite.
Currently there is no vaccine
yet available in the market for
humans against this disease and the
treatment depends on drugs with
limitations which is a serious con-
cern towards its complete elimina-
tion.
In India which has postponed
Kala Azar disease elimination goal
thrice with 2025 new deadline, 54
districts in Bihar, Jharkhand, Uttar
Pradesh, and West Bengal are still
affected by the disease with spo-
radic cases in other states like
Assam, Himachal Pradesh, Kerala,
Sikkim, and Uttarakhand.
The scientists including Prof
Vikash Kumar Dubey of the School
of Biochemical Engineering and
Prof Shyam Sundar of the depart-
ment of medicine, IMS, investigat-
ed and tested the new recombinant
vaccine on the mice infected with
the disease.
Dr Sunita Yadav, a National
Postdoctoral Fellow and Prof
Dubey who are investigator in the
study said that the prophylactic
potential of this vaccine was eval-
uated in preclinical studies in
mice model that showed a signif-
icant reduction in parasite load in
liver and spleen organs of vacci-
nated infected mice than infected
control mice. The research has
been recently reported in the pres-
tigious journal “Cellular
Immunology”.
“Clearance of the parasite bur-
den in vaccinated challenged mice
is correlated with immune
response expected in a vaccine
candidate,” said Professor Vikash
Kumar Dubey. It is a type of
defence mechanism that happens
in our body after vaccination and
helpful for prevention of disease
progression.
He said this study provides
insight towards the evaluation of
vaccine molecules against
Leishmania infection. In future, it
might be utilised as a vaccine can-
didate against the pathogen.
However, more study is needed to
better understand its mode of
action. The team next plans to fur-
ther evaluate its potential in other
clinical trials.
As of November 2020, 12
blocks in Jharkhand and 4 blocks
in Bihar reported more than 1 case
of Kala Azar per 10,000 popula-
tion. Uttar Pradesh and West
Bengal have also managed to sig-
nificantly achieve their elimination
target.
Kala Azar is the 2nd largest par-
asitic killer in the world after
Malaria and results in a 95 percent
fatality rate if the patients are not
treated. Additionally, up to 20 per
cent of the patients who are cor-
rectly treated and cured, develop a
skin condition called Post-Kala-
Azar Dermal Leishmaniasis (PKDL)
which surfaces within months to
years after treatment. These patients
can contain large amounts of par-
asites in their skin lesions, making
them an important source of trans-
mission, Dr Harsh Vardhan, Union
Health Minister recently pointed
out at a meeting held to review the
status of the disease.
FQSSY^UV_b;QQ1jQbdUcdUTQd28E
?=BQ =4F34;78
Prime Minister Narendra
Modi on Friday said the
country’s students should work
towards building a self-reliant
India. He said that by the time
India celebrates its 100th
Independence day, the nation
would also be celebrating the
efforts of the students who
would be graduating now.
“The universities of future
will be entirely virtual and stu-
dents from any part of the
world would be able to study
anywhere at anytime,” Modi
addressing students and fac-
ulty at the 18th convocation of
Tezpur University in Assam.
“We need to have a regu-
latory framework for such
transformation and we are
continuously trying to achieve
that goal with the New
Education Policy. The NEP
2020 aims at a flexible and
interdisciplinary education
system,” he said. The NEP
focuses on data and analytics.
It has the power to improve
the admission, teaching, and
evaluation system,” he added
in the virtual address.
Referring to the incuba-
tion centre of the university
and innovative technologies
emerging out of it, Modi told
students that they have great
opportunities ahead of them.
“Your efforts tell that you
have potential,” said the Prime
Minister. He also applauded
the efforts of varsity in the
documentation of tribal lan-
guages and culture, waste
energy among others.
“During the freedom
struggle, many brave hearts
from Assam have given their
lives now you have to live for
the AtmaNirbhar Bharat (self-
reliant India),” Modi told
graduating students asking
them to spread the tej (light)
of Tezpur University across
the nation and the world.
In this pandemic circum-
stances, the AtmaNirbhar
Bharat programme has
become a nomenclature in
our dictionary but we need to
understand what is this
change brought by the initia-
tive, said Modi. The biggest
change is of perspective – the
attitude of the entire nation
has changed, said Modi.
Union Education Minister
Ramesh Pokhriyal ‘Nishank’,
Assam Chief Minister
Sarbananda Sonowal, and
Tezpur Lok Sabha MP Pallab
Lochan Das also attended the
convocation.
Citing the Indian cricket
team’s recent win against
Australia, the Prime Minister
said the youth needs to take
inspiration from them. “The
young team was inexperi-
enced and injured, but that
didn’t deter their determina-
tion and beat one of the best
teams in the world,” he men-
tioned. A total of 1,218 stu-
dents received their degrees
and diplomas in the convoca-
tion.
`UZRUUcVddVd
)eYT`_g`TReZ`_
`WEVkafcgRcdZej
6WXGHQWVVKRXOGZRUN
WRZDUGVPDNLQJ,QGLD
VHOIUHOLDQWH[KRUWV30
?=BQ =4F34;78
The outbreak of avian
influenza, also known as
bird flu, has been confirmed in
poultry birds in as many as
nine States across the country,
and in crows, migratory/wild
birds in a dozen-odd 12 states,
the Union Ministry of Animal
Husbandry informed on
Friday.
In Rajasthan, bird flu has
been confirmed in 17 districts
of Rajasthan.
As many as 6,290 birds
have been found dead in the
state between December 25,
2020, and January 22, 2021, the
state Animal Husbandry
Department informed.
In Punjab, 11,200 birds
were culled at the Alfa Poultry
Farm in village Bhera in
Derabassi, Aashika Jain
Additional Deputy
Commissioner told a news
agency.
About a hundred men were
engaged in the operation who
worked for around eight hours
to conduct the exercise.
The team began the job
with sedation of birds, fol-
lowed by culling via cervical
dislocation. Thereafter the
birds were buried in deep pits
and covered with lime.
1XaSU[dX] !BcPcTb)2T]caT
?=BQ =4F34;78
The 9-feet statue of Govind
Ballabh Pant inside
Parliament premises has been
temporarily relocated and the
statue of Motilal Nehru will be
moved in the next two-three
days to make way for the con-
struction of the new building.
Meanwhile, the Central Public
Works Department has put
the central vista redevelop-
ment design in public domain
and has sought views and
objections till January 31.
Earlier this week, the
Central Public Works
Department had shifted the
16-feet bronze statue of
Mahatma Gandhi to a spot
between Gate 2 and 3 of the
Parliament. The construction
work of the new Parliament
building started on January 15
after the Heritage
Conservation Committee gave
its approval to the ambitious
project under the Central Vista
redevelopment plan.
“The statue of Pandit
Govind Ballabh Pant has been
temporarily relocated by the
CPWD. The statue of Motilal
Nehru, which is also coming in
the way of construction of the
new building, will also be
moved in the next two-three
days,” official sources said.
They said the statues being
moved temporarily will be
shifted to a prominent location
once the construction com-
pletes. There is also a statue of
B R Ambedkar which will be
moved temporarily, they said.
The new parliament build-
ing will have a triangular shape
and is expected to be com-
pleted by the 75th anniversary
of India’s independence in
2022. The Government plans
to hold the monsoon session of
Parliament in 2022 in the new
building. Prime Minister
Narendra Modi had laid the
foundation stone for the new
building, being constructed
by Tata Projects Ltd, on
December 10 last year. The
project is estimated to cost Rs
971 crore.
Besides the new
Parliament building, the rede-
velopment of the Central Vista
— the nation’s power corridor
—envisages a common central
secretariat, revamping of the 3-
km Rajpath from Rashtrapati
Bhavan to India Gate, new
prime minister’s residence and
prime minister’s office, and a
new Vice-President Enclave.
BcPcdT^U6^eX]S1P[[PQW
?P]cX]bXST?Pa[XPT]c
_aTXbTbaT[^RPcTS
?C8Q =4F34;78
Actor Sonu Sood moved
the Supreme Court Friday
challenging the Bombay High
Court order which dismissed
his appeal against a BMC
notice over alleged illegal con-
struction at his residential
building in Mumbai’s Juhu
area.
Advocate Vineet Dhanda,
who has filed the plea in the
top court, told PTI that Sood
has challenged the high court
order.
As per the BMC, the
Bollywood actor had carried
out structural changes in the
six-storey residential building
‘’Shakti Sagar’’, and converted
it into a hotel without taking
requisite permissions.
The BMC earlier this
month also filed a complaint at
the Juhu police station, seeking
an FIR to be lodged against
Sood for allegedly converting
the residential building into a
hotel without permission.
The complaint letter was
sent to the police after the
BMC inspected the building
and found that Sood had
allegedly not complied with the
requisitions and was continu-
ing unauthorised construction
even after the notice was
served to him in October last
year.
The police is yet to regis-
ter FIR in the case.
B^]dB^^S^eTbB2
PVPX]bc72^aSTa^]
X[[TVP[R^]bcadRcX^]
?C8Q =4F34;78
The Supreme Court on
Friday refused to accord
early hearing to the plea relat-
ed to mining major Vedanta’’s
Sterlite copper unit at Tuticorin
in Tamil Nadu which is closed
since May 2018 over pollution
concerns.
The top court, on
December 2, last year had
rejected the interim plea of
Vedanta Ltd that it be permit-
ted to inspect its Sterlite cop-
per plant and to operate it for
a month to assess the pollution
level.
Vedanta had sought hand-
ing over of the plant for three
months saying it requires two
months to start the unit and the
company should be allowed to
run it for four weeks to ascer-
tain whether its polluting or
not.
B2aTUdbTbTPa[hWTPaX]V
c^ETSP]cP´bBcTa[XcT
R^__Tad]Xc_[TP
C746E4A=4=C
?;0=BC7;3
C74=B=
B4BB8=5
?0A;804=C8=
!!!8=C74=4F
1D8;38=6
]PcX^]$
347A03D=kB0CDA30H k90=D0AH !!!
Agra: About 21 prisoners from Jammu and Kashmir,
presently lodged in various jails of Uttar Pradesh, have
been shifted to the high security Agra jail.
This is being done on the orders of the Union Home
Ministry (MHA). The prisoners being shifted now are
believed to be “pro-Pakistan” separatists, of which 10
are associated with Hurriyat leader Syed Ali Shah
Geelani.
These inmates were booked under Public Safety Act
(PSA) and were arrested in the wake of the revocation
of special status to the erstwhile state of Jammu and
Kashmir under Article 370 of the Constitution in August
2019.
According to Senior Superintendent of Agra cen-
tral jail, V.K. Singh, “While eight prisoners were
already lodged in Agra Central Jail, 17 more have been
shifted from Naini, Bareilly and Ambedkar Nagar jails.
Four more are scheduled to be transferred from
Varanasi Central Jail. All of them will be kept in a high-
security cell, away from the other prisoners.”
The entire cell is soundproof and under constant
CCTV surveillance. Sources said that the jail staff on
duty at the special cell have been strictly directed not
to speak to any prisoner. Only senior officials would
communicate with them, if needed.
They would be taken out of the lock-up one by one
at a fixed time every day and allowed to walk for a few
minutes.
Visitors and staffers would be thoroughly checked
at the main gate. The entire premises is being monitored
by police and provincial armed constabulary (PAC)
round-the-clock.
In 2019, over 200 prisoners booked under the PSA
were transferred to the Agra Central Jail. A year later,
most of them were 'temporarily' released on the direc-
tives of the MHA.The high-security cell at Agra cen-
tral jail was constructed 23 years ago and has a capac-
ity to lodge 30 prisoners. IANS
9:_aXb^]Tab
bWXUcTSc^0VaPYPX[
Mathura: An organisation here
hasdemandedtheinstallationof
a statue of demon king Ravan at
the Ram temple in Ayodhya.
In a letter to Prime Minister
Narendra Modi, the Lankesh
Bhakta Mandal made the
demand.
“The Lankesh Bhakta
Mandal will bear the cost
incurred on the installation of
the statue,” Omveer Saraswat,
president of the outfit said on
Friday.
A similar letter has also
beendispatchedtothepresident
of the Ramjanmabhoomi Nyas,
he said. PTI
Coimbatore: Panic gripped residents
of Madukkarai, near here, when they
saw a leopard attacking a dog in the
early hours of Friday, police said.
The visuals of the attack and ear-
lier incidents have gone viral in the
social media.
At least 20 goats and five dogs were
killed by the big cat in the last one year,
though the forest department person-
nel denied the presence of any leopard
in the area, the police said.
Adding to the fear of straying wild
elephants, the movement of the leopard
has made the residents anxious.
The incident, wherein the leopard
was seen attacking a dog at 1 AM on
Friday near the house of a government
transport driver, made them even more
scary, they said.
The residents managed to scare the
leopard away while the dog with deep
injury in the neck is battling for life, they
said.
The leopard then entered a near-
by house and killed three out of 17 goats,
they said.
The residents fear the leopard may
kill them too, as the human habitats are
on the foothill with the easy access to
wildlife, they added. Meanwhile, for-
est officials visited the spot and noticed
the pugmarks of the leopard. They
placed a cage to trap it and cameras to
monitor its movement. PTI
?P]XRVaX_b
aTbXST]cbPb
[T^_PaS^]_a^f[
PccPRZbS^V
Bengaluru: Karnataka Chief
Minister B S Yediyurappa on
Friday said five people were
killed in the powerful explosion
of a truckload of gelatin sticks
at a stone crushing unit in
Shivamogga district and
assured action against unlaw-
ful mining and those respon-
sible for the mishap.
Conceding illegal mining
in Shivamogga, his native dis-
trict, Yediyurappa said the
quarry owner and two of his
associates have been arrested
for the explosion that occurred
on Thursday night and he
would inspect the blast site on
Saturday. While police last
night said at least six labourers
in the truck were killed in the
explosion that left the bodies
dismembered beyond recogni-
tion, Yediyurappa told
reporters that five people were
dead.
Announcing an ex-gratia
of Rs five lakh each to the fam-
ilies of the victims, he said a
probe into the explosion was on
and a team of officials, includ-
ing those from bomb disposal,
mines and geology depart-
ments, were on the job. A
clear picture on the casualty
was expected to emerge soon
with the authorities not ruling
out the possibility of the death
toll increasing, citing reports
that there may have been more
people at the site when the
mishap occurred.
In a tweet, the Chief
Minister said: “My deepest
condolences to the bereaved
family members. I wish a
speedy recovery to the injured.”
He told reporters here that
he would direct the deputy
commissioner of Shivamogga
district to release a solatium of
Rs five lakh to the families of
the victims. “Tomorrow I am
going there. There are illegal
mining activities going on. I
will try to take steps to prevent
the repetition of such incidents
in future,” he said.
Yediyurappa assured
appropriate action against
those responsible for the explo-
sion, the cause of which was
under investigation. To a ques-
tion on allegations of increase
in illegal mining, he said such
activities have been stopped at
four to five places and stringent
action would be initiated to end
the menace altogether.
The chief minister said the
newly inducted Mines and
Geology Minister Murugesh
Nirani would soon inspect the
area. Yediyurappa''s son and
Shivamogga MP B Y
Raghavendra has already visit-
ed the spot.
The booming sound of the
blast initially made local peo-
ple mistake it for an earthquake
and it was heard in nearby areas
in neighbouring Davangere,
Chikkamagaluru and Uttara
Kannada districts too. PTI
AeQbbi_g^Ub_dXUbcQbbUcdUT+
3=Q^^_e^SUcC%Q[Xc_QdYe]
:0A=0C0:04G?;B8=
Chitrakoot (UP): A 15-year-
old girl was hacked to death
with an axe allegedly after
being raped and her four-year-
old nephew killed in a village
here, police said on Friday.
A 30-year-old man from
the girl's village has been arrest-
ed in connection with the
crime which took place on
Thursday, they said.
“The body of the girl was
found in a village on Thursday.
She was hacked to death with
an axe,” Superintendent of
Police Ankit Mittal said.
Her nephew was also
attacked. He was rushed to the
hospital where he died during
treatment, he said.
Circle Officer Subodh
Gautam said the girl was
attacked when she was return-
ing home after giving food to
her father in the field.
“Accused Chilua has been
arrested by the police. The
motive behind the crime is
being probed,” the officer said.
Gautam said the teenager's
family has alleged that she was
raped before being murdered.
It will be confirmed after the
post-mortem examination.
“The post-mortem report
is awaited,” he said. PTI
?8=44A=4FBB4AE824Q 90D
The Administrative Council (AC), which
met here under the chairmanship of
Lieutenant Governor, Manoj Sinha on Friday
approved the adoption of Jammu  Kashmir
Industrial Land Allotment Policy, 2021-30 to
evolve a highly structured industrial land
bank for promoting equitable industrial
growth in Jammu and Kashmir.
The new policy attempts to address var-
ious land-related issues impeding industri-
al development in JK by laying down a
framework to regulate zoning of industrial
areas, project appraisal and evaluation, and
the subsequent process flow.
According to the official spokesperson,
“Under the policy, land will be allotted to the
investors on lease for an initial period of 40
years, extendable to 99 years.
The allotted land will be liable to be can-
celled in case of failure of the investor to take
effective steps within the stipulated time of
2 years, failure of the industrial unit to come
into production within 3 years, violation of
provisions under the lease deed, and non-
cooperation of an enterprise for a period of
5 years”.
Further, the policy also provides renting
out of 60% of the built-up area of a business
enterprise for setting up an ancillary indus-
trial enterprise through a tripartite agree-
ment.
The spokesperson said, “the policy aims
at achieving inclusive growth through sus-
tainable industrialization and employment
generation, and includes provisions for
evolving a fair and transparent mechanism
for land allotment for industrial use”.
“The new policy proposes zoning of
industrial areas at block/ municipality level
after taking into consideration various fac-
tors including the existing level of industri-
al development, location of the proposed
zone, and level of urbanization. The Jammu
and Kashmir Industrial Land Allotment
Policy, 2021-30 will also cover land allotment
for health institutions/medi-cities and edu-
cational institutions/edu-cities”, official
spokesperson added.
The policy provides for constitution of
Divisional Level Project Appraisal and
Evaluation Committees to scrutinize appli-
cations received for allotment of industrial
land within 30 days; Apex Level Land
Allotment Committee, High Level Land
Allotment Committee and Divisional Level
Land Allotment Committee to decide and
allot industrial land to the applicant within
45 days in cases of projects worth Rs. 200
crore, Rs. 50-200 crore and up to Rs. 50 crore,
respectively.
-	.,QGXVWULDOODQGDOORWPHQW
SROLFDSSURYHG
Kolkata: The Election
Commission of India on Friday
asked the Bengal political parties
to exercise restraint while choos-
ing their words particularly for
armed forces.
While it termed the allega-
tions made by Trinamool
Congress against the Border
Security Forces without producing
evidence as “unfortunate” and
avoidable, it also called the BJP’
contentions that the names of 4-
5 lakh Rohingyas had been ille-
gally included in the electoral rolls
as unsubstantiated.
Describing allegations made
by a political party against the BSF
as “unfortunate,” Chief Election
Commissioner Sunil Arora said
that it was “one of the finest
forces in the country,” adding the
political party concerned should
come up with facts to support its
allegations.
Earlier the Trinamool
Congress alleged that the BSF was
threatening people living (within
15 km) of the international bor-
der to make them cast their votes
in favour of a particular political
party.
On BJP’s allegations that the
names of 4-5 lakh Rohingyas had
been incorporated in the electoral
rolls he said such allegations were
baseless adding the full bench of
the EC which was currently trav-
eling Bengal had asked the State
Chief Secretary and Home
Secretary to look into the issues of
fake information in the social
media raised by political parties.
Talking tough on the bureau-
crats particularly the police top
brass the CEC said that poll panel
had “zero-tolerance” insofar as
“money and muscle power and
misuse of the government machin-
ery”wasconcerned.Healsosaidno
civic police volunteers will be
deployed during the elections.
Sources said that the ECI was
mulling “transfer, suspensions
and even charge-sheets” against
officials acting with bias. “The
Commission may blacklist offi-
cials and even suspend, transfer or
charge-sheet them,” sources said,
adding, “like on earlier occasions
any complaint, instead of being
responded with show cause
notices will be followed up with
prompt removal.” PNS
Raipur:Breaking the
paddy procurement
record of last 20
years, Chhattisgarh
State has recorded
highest quantity of
paddy procurement
this year. In the ongo-
ing procurement sea-
son this year, nearly 84 lakh 44
thousand metric tons of paddy
has been procured till January
21, which is 50 thousand met-
ric tons more than the quanti-
ty of paddy procured last year.
It is noteworthy that nearly
83.94 lakh metric tons of paddy
was procured in the season of
last year.
Under the leadership of
Chief Minister Mr. Bhupesh
Baghel, the quantity of paddy
procurement as well as the
number of farmers and agri-
culture yield has consistently
increased in last two years. As
a result of State Government’s
pro-farmer policy,
Chhattisgarh is
emerging as a
model state for the
country in the agri-
culture sector.
C h h a t t i s g a r h
Government’s Rajiv
Gandhi Kisaan
Nyay Yojana has boosted the
crop production in the state. In
the current fiscal year, State
Government has distributed
the incentive amount of Rs
5750 crore to 19 lakh farmers of
the state under Rajiv Gandhi
Kisaan Nyay Yojana. Till date, 19
lakh 54 thousand 332 farmers
have sold paddy at support
price till date.
DO of 27 lakh 70 thousand
693 metric tons of paddy has
been issued to the millers for
custom milling, against which
nearly 25 lakh 45 thousand
512 metric tons of paddy has
been transported already.
Amaravati (AP): At least 22
people Fell ill in Eluru city and
anearbymandalheadquartersin
West Godavari district of
Andhra Pradesh on Friday but
Deputy Chief Minister (Health)
A K K Srinivas suspected there
could be a “conspiracy” behind
it.
This comes more than a
month after several hundred
people in Eluru fell ill with
symptoms of nausea in the first
week of December last year.
The Deputy Chief Minister,
who visited Poolla in West
Godavari district and enquired
about the situation from the vic-
tims'families,saidtheycouldnot
rule out a conspiracy behind the
outbreak of the mysterious ill-
ness. “We are thinking if there
is a conspiracy.We have this sus-
picion, going by what the peo-
ple here said.So, we can't rule
that out.But we can't confirm
that as well,” Srinivas told a
Telugu television news channel.
Official sources said the 22
persons suddenly fell uncon-
scious as froth oozed from their
mouths and they complained of
giddiness.
“Six of these patients have
been discharged after treatment
while 15 were admitted to the
District Hospital in
Eluru.Another person was get-
ting treated in the local hospi-
tal in Poolla mandal headquar-
ters,” a senior official said.
“We have collected water
and food samples from the
houses of the victims and also
nearby hotels and the wholesale
vegetable market at
Gundugolanu.We are collecting
samples of meat, chicken, milk,
riceandfertilisersusedinpaddy
cultivation,” he added.
ChiefSecretaryAdityaNath
Das, Principal Secretary
(Health) Anil Kumar Singhal,
Health Commissioner
Katamaneni Bhaskar rushed to
Eluru to take stock of the situ-
ation. PTI
C2aTPaZ^]1B5
d]U^acd]PcTbPhb42
C=A067D=0C70Q D108
Aday after a massive fire
claimed five lives and gut-
ted its equipment and products
at the proposed BCG and
Rotavirus vaccine manufac-
turing facility, Serum Institute
of India (SII) on Friday pegged
the losses suffered by it at Rs
1,000 crore, even as
Maharashtra chief minister
Uddhav Thackeray visited the
fire ravaged SII premises.
Addressing a joint news
conference with the chief min-
ister, SII’s Chief Executive
Officer (CEO) Adar Poonawala
said that there was no damage
to the place where Covishield
was manufactured and stored.
“The mishap took place at a
brand new facility. It was for the
future production of BCG and
Rotavirus,” he said.
“Equipment and products
worth Rs 1,000 crore were
damaged in the fire... The loss
is mainly financial. There is no
loss to supplies as such,”
Poonawalla said.
Poonawala said that at the
place where the fire broke out,
“no actual vaccine was actual-
ly being produced there, so
there was no damage to any
vaccine”.
While the fire swept
through the third and fourth
floors of the upcoming facility
in Manjari that was scheduled
to become operational within
a month, the Covishield
Vaccine that is currently being
manufactured at its other plant
which is one km away.
The chief minister, accom-
panied by Tourism Minister
Aditya Thackeray, Deputy
Chairperson of Maharashtra
Legislative Council Neelam
Gorhe, Pune MP Girish Bapat,
visited the SII facility and met
the company Chairman Cyrus
Poonawalla and his son Adar.
Declining to comment on
the progress of investigations
into the circumstances leading
to Thursday’s fire, Uddhav
said: “We have ordered a thor-
ough probe. There cannot be
any conclusions till the full
investigations are complete and
the report is available. It is then
we will know whether it was an
accident or sabotage” the chief
minister said.
The chief minister said
that Poonawallas had repeat-
edly assured him that there
would be no impact on the
Covishield Vaccine produc-
tion, stocks and rollout which
would continue unhindered.
After the chief minister’s
visit to the mishap-hit SII facil-
ity, Adar Poonwala tweeted:
“Thank you Shri Uddhav Ji
@CMOMaharashtraand
@AUThackerayfor visiting
@SerumInstIndiaand extend-
ing your help and support dur-
ing this terrible crisis. As you
have seen, the production of
#COVISHIELD is on schedule
and remains unaffected by this
tragedy.
Meanwhile, the SII has
announced a compensation of
Rs 25 lakh to the next of kin of
each of the five labourers,
including 3 migrants, killed in
the blaze.
On his part, the chief min-
ister said that if any more
assistance was needed to be
extended to the bereaved fam-
ilies, the state government
would consider it.
In a related development,
Pune’s Hadapsar Police have
registered an accidental death,
the Pune Municipal
Corporation, Pune
Metropolitan Region
Development Authority and
Maharashtra Industrial
Development Corporation
have launched simultaneous
investigations into the fire.
It may be recalled that five
persons were killed and others
evacuated safely after a massive
fire broke out in an under-con-
struction building at the Covid-
19 vaccine manufacturer
Serum Institute of India (SII) in
Pune on Thursday afternoon.
The fire, which broke out
at around 2.30 pm, swept
through the fourth and fifth
floors of an under-construction
building at Manjari, which is
one kilometer away from the
SII facility where Covid vac-
cines are being manufactured.
Manjari is a complex in Special
Economic Zone where SII’s
half a dozen buildings are
being constructed. The fire
was brought under control
within three hours.
The five deceased labour-
ers were identified as Rama
Shankar Harijan and Bipin
Saroj, both from Uttar Pradesh,
Sushil Kumar Pandey, who
hails from Bihar and
Mahendra Ingle and Pratik
Pashte, both residents of Pune.
All of them were contractual
labourers. They were carrying
out some electrical work at the
site, when the mishap
occurred.
C=A067D=0C70Q D108
As part of its ongoing inves-
tigations into the Punjab 
Maharashtra Cooperative
(PMC) Bank Ltd. scam, the
Enforcement Directorate (ED)
on Friday raided five premises
belonging to the Viva Group
and its associates in Mumbai
and Palghar and seized a cash
of Rs 73 lakh.
Following upon the leads
got it by that a large amount of
money had allegedly been
transferred from HDIL to
Mehul Thakur-controlled com-
panies and trusts the ED raid-
ed Viva Group’s offices at
Andheri and Virar in Palghar
district, residences of its top
officials at Andheri, Juhu and
Chembur in Mumbai.
In the raids conducted on
three premises linked to the
Viva Groups’ head and two
others connected with char-
tered accountants/financial
consultants, the ED seized Rs
73 lakh in cash and incrimi-
nating documents.
It may be recalled that
after the PMC bank scam broke
out in September 2019, the
Economic Offences Wing
(EOW) of Mumbai Police had
arrested two promoters of the
Housing Development and
Infrastructure Limited (HDIL)
Sarang Kumar Wadhawan and
Rakesh Wadhawan in connec-
tion with 5366 crore PMC
Bank scam.
Subsequently, the ED
launched a probe against
HDIL’s promoters Rakesh
Wadhawan and Sarang
Wadhawan, PMC Bank’s for-
mer Chairman Waryam Singh
and MD Joy Thomas, in con-
nection with the same scam.
The ED seized several
properties of Rakesh
Wadhawan and Wadhawan
Family Trust worth Rs.293
crore, while it also seized jew-
ellery worth Rs.63 crore were
seized and attached and
launched proceedings against
them under the Prevention of
Money-laundering Act
(PMLA).
The investigations had
revealed that the Wadhawans
and Viva Group connived to
divert over Rs.160-crore from
HDIL to many companies of
the latter (Viva Group) dis-
guised as ‘commission’, though
the funds were apparently an
illegal diversion from the PMC
Bank.
Simultaneously, the ED
started probing another case
against Rakesh Wadhawan and
Sarang Wadhawan for siphon-
ing off a long of Rs.200 crore
sanctioned by Yes Bank to the
Mack Star Marketing Pvt. Ltd.,
by allegedly showing some fic-
titious purposes.
XPWP2CWPRZTaPheXbXcb_aTXbTb
XB88´b24bPhb]^SPPVTRPdbTSc^ePRRX]T
30 EDQNVFDP('UDLGV9LYDJURXS
DVVRFLDWHV¶SUHPLVHVVHL]HVC/FDVK
B0D60AB4=6D?C0Q :;:0C0
Amid speculation that more
politicians might join the
BJP ranks during Home
Minister Amit Shah's January
31 rally in Howrah, another
Bengal Minister Rajib Banerjee
on Friday put in his papers
holding out some emotional
details before the media
moments after tendering his
resignation to Governor
Jagdeep Dhankhar.
An hour later, Chief
Minister Mamata Banerjee
reportedly removed the
Forest Minister from his posi-
tion because there were some
procedural lapses on his part in
tendering his resignation.
Sources at State Secretariat
Nabanna said that he was being
removed as he had tendered his
resignation to the Governor
instead of the Chief Minister
who was his official appointee
as the leader of the Cabinet.
While the Trinamool
Congress leadership promptly
responded to the latest resig-
nation drama saying a bucket
of water taken out of the ocean
would not matter much,
besides raising some feeble
corruption charges against the
just former Minister who
was yet to quit the party, Rajib
said he had made up his mind
to resign more than two years
ago after the Chief Minister
removed him unceremonious-
ly as the Irrigation Minister.
Most regretfully I inform
you that I have tendered my
resignation from my office as
Cabinet Minister being in
charge of Forest Department,
an emotional Rajib Banerjee
said adding he had never
thought that such a situation
will come someday … but I had
taken a decision more than two
years ago when the Chief
Minister removed me from
the Irrigation Department
without any prior intimation …
I had to know it from the tele-
vision breaking news even as I
was busy meeting my party
men in North Bengal.
It was a hurtful situation as
the Chief Minister should at
least have informed me before
taking such decision … it
should be the minimum cour-
tesy … there is no problem in
changing portfolios by the
Chief Minister who is the mas-
ter of the situation … but there
is a way to do things … and
why I still continued as the
Forest Minister is because
when I told her that I was quit-
ting from all Government posts
she persuaded me to continue
and I could not disregard her
requests at that point in time.
Rajib is still an MLA, a
party member said that he
would continue to work for
the people in future, dropping
suggestions that he was in look
out for some platform.
He said, I do not know
which platform I will get and
from where I will work for the
people but I will continue to
work for them till I am alive.
Moments after Bengal BJP
president Dilip Ghosh offered
him a platform saying though
he still continues to be a TMC
leader we have not problem
accepting him in our party
should he decide to join us.
Rajib is the third Minister
to resign from the Government
in a month after Suvendu
Adhikari and Laxmi Ratan
Shukla.
Rajib had been critical of
the Government and the party
telling openly in the public how
corrupt sidekicks of top lead-
ership always got the plum
positions and the dedicated
ones were ignored. In a
Facebook Live post he rued the
falling economic condition of
Bengal where the youth were
forced to leave the State in lakhs
in search of jobs.
Reacting to the Friday's
development Bengal Minister
and TMC general secretary
Partho Chatterjee said a buck-
et of water taken out of the
ocean does not dry it up and
the TMC is that ocean, while
Trinamool MP Kalyan
Banerjee made suggestive state-
ments saying the Forest
Minister was aggrieved because
he was removed from the
Irrigation Department where
he had the opportunity to work
with a large number of con-
tractors.
$QRWKHU%HQJDO0LQ
TXLWVPDMRLQ%-3
7XVWTbc`dP]cXch^U_PSSh
_a^RdaTScWXbhTPaX]2WWPccXbVPaW
jVRc`]UXZc]_VaYVhZ]]VUZ_
FAd4YZecR``e,cRaVdfdaVTeVU
SHRSOHIDOOLOOLQ(OXUX$3
'HSXW0VXVSHFWVFRQVSLUDF
Dhaka: Bangladesh Prime
Minister Sheikh Hasina has
thanked her Indian counter-
part Narendra Modi for send-
ing over two million doses of
Covid-19 vaccine as a gift to
Bangladesh.
India on Thursday offi-
cially handed over 2 million
doses of domestically pro-
duced Covishield vaccine to
Bangladesh. The vaccines were
provided at a crucial time
when the number of coron-
avirus cases in Bangladesh is
rising.
“I thank Prime Minister
Narendra Modi for sending the
vaccine (batch) as a gift,”
Hasina said at an online inter-
national conference held on the
occasion of the 100th founding
anniversary of the University of
Dhaka on Thursday.
She said the government
has already planned how it
would proceed with the vac-
cine, the Dhaka Tribune
reported.
“We have taken all the
steps to face the COVID-19 sit-
uation in the country,” Hasina
said. Apart from the current
delivery of vaccines,
Bangladesh is also set to pur-
chase 3 crore doses of India-
made coronavirus vaccine.
Hasina hoped that the vac-
cine that Bangladesh procured
from India would arrive by
January 25-26, the report said.
Bangladesh has so far
recorded 7,966 COVID-19
deaths since the outbreak of the
pandemic in March last year,
while the total number of
infections have surged to over
530,270. PTI
%
GHVK30+DVLQDWKDQNV
0RGLIRURYLGYDFFLQHJLIW
PcWdaP^dcUXcbTTZbAPeP]
bcPcdTPc0h^SWhPcT_[T
D::A68D7:C6=@DD2EC!!!4C
Pioneer Dehradun-english-edition-2021-01-23
Pioneer Dehradun-english-edition-2021-01-23
Pioneer Dehradun-english-edition-2021-01-23
Pioneer Dehradun-english-edition-2021-01-23
Pioneer Dehradun-english-edition-2021-01-23
Pioneer Dehradun-english-edition-2021-01-23

Weitere ähnliche Inhalte

Was ist angesagt?

Was ist angesagt? (20)

First india jaipur edition-05 january 2021
First india jaipur edition-05 january 2021First india jaipur edition-05 january 2021
First india jaipur edition-05 january 2021
 
Pioneer dehradun-e-paper-09-06-2020
Pioneer dehradun-e-paper-09-06-2020Pioneer dehradun-e-paper-09-06-2020
Pioneer dehradun-e-paper-09-06-2020
 
161946442327042021 first india jaipur
161946442327042021 first india jaipur161946442327042021 first india jaipur
161946442327042021 first india jaipur
 
First India-Ahmedabad Edition-04 May 2021
First India-Ahmedabad Edition-04 May 2021First India-Ahmedabad Edition-04 May 2021
First India-Ahmedabad Edition-04 May 2021
 
First India-Ahmedabad Edition-28 April 2021
First India-Ahmedabad Edition-28 April 2021First India-Ahmedabad Edition-28 April 2021
First India-Ahmedabad Edition-28 April 2021
 
Pioneer Dehradun-english-edition-2020-12-10
Pioneer Dehradun-english-edition-2020-12-10Pioneer Dehradun-english-edition-2020-12-10
Pioneer Dehradun-english-edition-2020-12-10
 
First india ahmedabad edition-10 august 2020
First india ahmedabad edition-10 august 2020First india ahmedabad edition-10 august 2020
First india ahmedabad edition-10 august 2020
 
Pioneer dehradun-english-edition-2021-08-12
Pioneer dehradun-english-edition-2021-08-12Pioneer dehradun-english-edition-2021-08-12
Pioneer dehradun-english-edition-2021-08-12
 
Pioneer Dehradun-english-edition-2020-12-24
Pioneer Dehradun-english-edition-2020-12-24Pioneer Dehradun-english-edition-2020-12-24
Pioneer Dehradun-english-edition-2020-12-24
 
Pioneer Dehradun-english-edition-2020-12-21
Pioneer Dehradun-english-edition-2020-12-21Pioneer Dehradun-english-edition-2020-12-21
Pioneer Dehradun-english-edition-2020-12-21
 
Pioneer Dehradun-english-edition-2020-10-23
Pioneer Dehradun-english-edition-2020-10-23Pioneer Dehradun-english-edition-2020-10-23
Pioneer Dehradun-english-edition-2020-10-23
 
First india lucknow edition-05 january 2021
First india lucknow edition-05 january 2021First india lucknow edition-05 january 2021
First india lucknow edition-05 january 2021
 
Pioneer Dehradun-english-edition-2021-02-18
Pioneer Dehradun-english-edition-2021-02-18Pioneer Dehradun-english-edition-2021-02-18
Pioneer Dehradun-english-edition-2021-02-18
 
Pioneer Dehradun-english-edition-2020-12-05
Pioneer Dehradun-english-edition-2020-12-05Pioneer Dehradun-english-edition-2020-12-05
Pioneer Dehradun-english-edition-2020-12-05
 
First india lucknow edition-12 january 2021
First india lucknow edition-12 january 2021First india lucknow edition-12 january 2021
First india lucknow edition-12 january 2021
 
First India-Lucknow Edition-07 May 2021
First India-Lucknow Edition-07 May 2021First India-Lucknow Edition-07 May 2021
First India-Lucknow Edition-07 May 2021
 
Pioneer Dehradun english-edition-2021-01-15
Pioneer Dehradun english-edition-2021-01-15Pioneer Dehradun english-edition-2021-01-15
Pioneer Dehradun english-edition-2021-01-15
 
First india jaipur edition-13 january 2021
First india jaipur edition-13 january 2021First india jaipur edition-13 january 2021
First india jaipur edition-13 january 2021
 
Pioneer dehradun-english-edition-2021-05-31
Pioneer dehradun-english-edition-2021-05-31Pioneer dehradun-english-edition-2021-05-31
Pioneer dehradun-english-edition-2021-05-31
 
Pioneer Dehradun-english-edition-2021-01-18
Pioneer Dehradun-english-edition-2021-01-18Pioneer Dehradun-english-edition-2021-01-18
Pioneer Dehradun-english-edition-2021-01-18
 

Ähnlich wie Pioneer Dehradun-english-edition-2021-01-23

Ähnlich wie Pioneer Dehradun-english-edition-2021-01-23 (20)

First india ahmedabad edition-05 january 2021
First india ahmedabad edition-05 january 2021First india ahmedabad edition-05 january 2021
First india ahmedabad edition-05 january 2021
 
Pioneer Dehradun-english-edition-2021-03-12
Pioneer Dehradun-english-edition-2021-03-12Pioneer Dehradun-english-edition-2021-03-12
Pioneer Dehradun-english-edition-2021-03-12
 
Pioneer-Dehradun-english-edition-2020-12-04
Pioneer-Dehradun-english-edition-2020-12-04Pioneer-Dehradun-english-edition-2020-12-04
Pioneer-Dehradun-english-edition-2020-12-04
 
Pioneer Dehradun-english-edition-2021-02-01
Pioneer Dehradun-english-edition-2021-02-01Pioneer Dehradun-english-edition-2021-02-01
Pioneer Dehradun-english-edition-2021-02-01
 
Pioneer Dehradun-english-edition-2021-01-13
Pioneer Dehradun-english-edition-2021-01-13Pioneer Dehradun-english-edition-2021-01-13
Pioneer Dehradun-english-edition-2021-01-13
 
First india jaipur edition-12 january 2021
First india jaipur edition-12 january 2021First india jaipur edition-12 january 2021
First india jaipur edition-12 january 2021
 
Pioneer dehradun-english-edition-2021-05-24
Pioneer dehradun-english-edition-2021-05-24Pioneer dehradun-english-edition-2021-05-24
Pioneer dehradun-english-edition-2021-05-24
 
First india ahmedabad edition-16 january 2021
First india ahmedabad edition-16 january 2021First india ahmedabad edition-16 january 2021
First india ahmedabad edition-16 january 2021
 
Pioneer Dehradun-english-edition-2021-01-09
Pioneer Dehradun-english-edition-2021-01-09Pioneer Dehradun-english-edition-2021-01-09
Pioneer Dehradun-english-edition-2021-01-09
 
Pioneer dehradun-english-edition-2021-09-15
Pioneer dehradun-english-edition-2021-09-15Pioneer dehradun-english-edition-2021-09-15
Pioneer dehradun-english-edition-2021-09-15
 
Pioneer Dehradun-english-edition-2021-01-21
Pioneer Dehradun-english-edition-2021-01-21Pioneer Dehradun-english-edition-2021-01-21
Pioneer Dehradun-english-edition-2021-01-21
 
Pioneer dehradun-english-2021-07-21
Pioneer dehradun-english-2021-07-21Pioneer dehradun-english-2021-07-21
Pioneer dehradun-english-2021-07-21
 
Pioneer Dehradun-english-edition-2020-10-15
Pioneer Dehradun-english-edition-2020-10-15Pioneer Dehradun-english-edition-2020-10-15
Pioneer Dehradun-english-edition-2020-10-15
 
Pioneer Dehradun english-edition-2021-01-16
Pioneer Dehradun english-edition-2021-01-16Pioneer Dehradun english-edition-2021-01-16
Pioneer Dehradun english-edition-2021-01-16
 
Pioneer Dehradun english-edition-2020-12-12
Pioneer Dehradun english-edition-2020-12-12Pioneer Dehradun english-edition-2020-12-12
Pioneer Dehradun english-edition-2020-12-12
 
20112021 first india ahmedabad
20112021 first india ahmedabad20112021 first india ahmedabad
20112021 first india ahmedabad
 
First india ahmedabad edition-12 january 2021
First india ahmedabad edition-12 january 2021First india ahmedabad edition-12 january 2021
First india ahmedabad edition-12 january 2021
 
17012022 first india lucknow
17012022 first india lucknow17012022 first india lucknow
17012022 first india lucknow
 
First india ahmedabad edition-02 march 2021
First india ahmedabad edition-02 march 2021First india ahmedabad edition-02 march 2021
First india ahmedabad edition-02 march 2021
 
Pioneer Dehradun-english-edition-2021-02-05
Pioneer Dehradun-english-edition-2021-02-05Pioneer Dehradun-english-edition-2021-02-05
Pioneer Dehradun-english-edition-2021-02-05
 

Mehr von DunEditorial

Pioneer dehradun-english-edition-2021-09-17
Pioneer dehradun-english-edition-2021-09-17Pioneer dehradun-english-edition-2021-09-17
Pioneer dehradun-english-edition-2021-09-17
DunEditorial
 

Mehr von DunEditorial (20)

Pioneer dehradun-english-edition-2021-09-30
Pioneer dehradun-english-edition-2021-09-30Pioneer dehradun-english-edition-2021-09-30
Pioneer dehradun-english-edition-2021-09-30
 
Pioneer dehradun-english-edition-2021-09-29
Pioneer dehradun-english-edition-2021-09-29Pioneer dehradun-english-edition-2021-09-29
Pioneer dehradun-english-edition-2021-09-29
 
Pioneer dehradun-english-edition-2021-09-28
Pioneer dehradun-english-edition-2021-09-28Pioneer dehradun-english-edition-2021-09-28
Pioneer dehradun-english-edition-2021-09-28
 
Pioneer dehradun-english-edition-2021-09-27
Pioneer dehradun-english-edition-2021-09-27Pioneer dehradun-english-edition-2021-09-27
Pioneer dehradun-english-edition-2021-09-27
 
Pioneer dehradun-english-edition-2021-09-26
Pioneer dehradun-english-edition-2021-09-26Pioneer dehradun-english-edition-2021-09-26
Pioneer dehradun-english-edition-2021-09-26
 
Pioneer dehradun-english-edition-2021-09-25
Pioneer dehradun-english-edition-2021-09-25Pioneer dehradun-english-edition-2021-09-25
Pioneer dehradun-english-edition-2021-09-25
 
Pioneer dehradun-english-edition-2021-09-24
Pioneer dehradun-english-edition-2021-09-24Pioneer dehradun-english-edition-2021-09-24
Pioneer dehradun-english-edition-2021-09-24
 
Pioneer dehradun-english-edition-2021-09-23
Pioneer dehradun-english-edition-2021-09-23Pioneer dehradun-english-edition-2021-09-23
Pioneer dehradun-english-edition-2021-09-23
 
Pioneer dehradun-english-edition-2021-09-22
Pioneer dehradun-english-edition-2021-09-22Pioneer dehradun-english-edition-2021-09-22
Pioneer dehradun-english-edition-2021-09-22
 
Pioneer dehradun-english-edition-2021-09-20
Pioneer dehradun-english-edition-2021-09-20Pioneer dehradun-english-edition-2021-09-20
Pioneer dehradun-english-edition-2021-09-20
 
Pioneer dehradun-english-edition-2021-09-19
Pioneer dehradun-english-edition-2021-09-19Pioneer dehradun-english-edition-2021-09-19
Pioneer dehradun-english-edition-2021-09-19
 
Pioneer dehradun-english-edition-2021-09-18
Pioneer dehradun-english-edition-2021-09-18Pioneer dehradun-english-edition-2021-09-18
Pioneer dehradun-english-edition-2021-09-18
 
Pioneer dehradun-english-edition-2021-09-17
Pioneer dehradun-english-edition-2021-09-17Pioneer dehradun-english-edition-2021-09-17
Pioneer dehradun-english-edition-2021-09-17
 
Pioneer dehradun-english-edition-2021-09-16
Pioneer dehradun-english-edition-2021-09-16Pioneer dehradun-english-edition-2021-09-16
Pioneer dehradun-english-edition-2021-09-16
 
Pioneer dehradun-english-edition-2021-09-14
Pioneer dehradun-english-edition-2021-09-14Pioneer dehradun-english-edition-2021-09-14
Pioneer dehradun-english-edition-2021-09-14
 
Pioneer dehradun-english-edition-2021-09-13
Pioneer dehradun-english-edition-2021-09-13Pioneer dehradun-english-edition-2021-09-13
Pioneer dehradun-english-edition-2021-09-13
 
Pioneer dehradun-english-edition-2021-09-12
Pioneer dehradun-english-edition-2021-09-12Pioneer dehradun-english-edition-2021-09-12
Pioneer dehradun-english-edition-2021-09-12
 
Pioneer dehradun-english-edition-2021-09-11
Pioneer dehradun-english-edition-2021-09-11Pioneer dehradun-english-edition-2021-09-11
Pioneer dehradun-english-edition-2021-09-11
 
Pioneer dehradun-english-edition-2021-09-10
Pioneer dehradun-english-edition-2021-09-10Pioneer dehradun-english-edition-2021-09-10
Pioneer dehradun-english-edition-2021-09-10
 
Pioneer dehradun-english-edition-2021-09-09
Pioneer dehradun-english-edition-2021-09-09Pioneer dehradun-english-edition-2021-09-09
Pioneer dehradun-english-edition-2021-09-09
 

Kürzlich hochgeladen

9953056974 Call Girls In Pratap Nagar, Escorts (Delhi) NCR
9953056974 Call Girls In Pratap Nagar, Escorts (Delhi) NCR9953056974 Call Girls In Pratap Nagar, Escorts (Delhi) NCR
9953056974 Call Girls In Pratap Nagar, Escorts (Delhi) NCR
9953056974 Low Rate Call Girls In Saket, Delhi NCR
 
The political system of the united kingdom
The political system of the united kingdomThe political system of the united kingdom
The political system of the united kingdom
lunadelior
 
call girls inMahavir Nagar (delhi) call me [🔝9953056974🔝] escort service 24X7
call girls inMahavir Nagar  (delhi) call me [🔝9953056974🔝] escort service 24X7call girls inMahavir Nagar  (delhi) call me [🔝9953056974🔝] escort service 24X7
call girls inMahavir Nagar (delhi) call me [🔝9953056974🔝] escort service 24X7
9953056974 Low Rate Call Girls In Saket, Delhi NCR
 

Kürzlich hochgeladen (17)

9953056974 Call Girls In Pratap Nagar, Escorts (Delhi) NCR
9953056974 Call Girls In Pratap Nagar, Escorts (Delhi) NCR9953056974 Call Girls In Pratap Nagar, Escorts (Delhi) NCR
9953056974 Call Girls In Pratap Nagar, Escorts (Delhi) NCR
 
The political system of the united kingdom
The political system of the united kingdomThe political system of the united kingdom
The political system of the united kingdom
 
06052024_First India Newspaper Jaipur.pdf
06052024_First India Newspaper Jaipur.pdf06052024_First India Newspaper Jaipur.pdf
06052024_First India Newspaper Jaipur.pdf
 
China's soft power in 21st century .pptx
China's soft power in 21st century   .pptxChina's soft power in 21st century   .pptx
China's soft power in 21st century .pptx
 
Dubai Call Girls Pinky O525547819 Call Girl's In Dubai
Dubai Call Girls Pinky O525547819 Call Girl's In DubaiDubai Call Girls Pinky O525547819 Call Girl's In Dubai
Dubai Call Girls Pinky O525547819 Call Girl's In Dubai
 
Politician uddhav thackeray biography- Full Details
Politician uddhav thackeray biography- Full DetailsPolitician uddhav thackeray biography- Full Details
Politician uddhav thackeray biography- Full Details
 
Unveiling the Characteristics of Political Institutions_ A Comprehensive Anal...
Unveiling the Characteristics of Political Institutions_ A Comprehensive Anal...Unveiling the Characteristics of Political Institutions_ A Comprehensive Anal...
Unveiling the Characteristics of Political Institutions_ A Comprehensive Anal...
 
America Is the Target; Israel Is the Front Line _ Andy Blumenthal _ The Blogs...
America Is the Target; Israel Is the Front Line _ Andy Blumenthal _ The Blogs...America Is the Target; Israel Is the Front Line _ Andy Blumenthal _ The Blogs...
America Is the Target; Israel Is the Front Line _ Andy Blumenthal _ The Blogs...
 
11052024_First India Newspaper Jaipur.pdf
11052024_First India Newspaper Jaipur.pdf11052024_First India Newspaper Jaipur.pdf
11052024_First India Newspaper Jaipur.pdf
 
call girls inMahavir Nagar (delhi) call me [🔝9953056974🔝] escort service 24X7
call girls inMahavir Nagar  (delhi) call me [🔝9953056974🔝] escort service 24X7call girls inMahavir Nagar  (delhi) call me [🔝9953056974🔝] escort service 24X7
call girls inMahavir Nagar (delhi) call me [🔝9953056974🔝] escort service 24X7
 
05052024_First India Newspaper Jaipur.pdf
05052024_First India Newspaper Jaipur.pdf05052024_First India Newspaper Jaipur.pdf
05052024_First India Newspaper Jaipur.pdf
 
declarationleaders_sd_re_greens_theleft_5.pdf
declarationleaders_sd_re_greens_theleft_5.pdfdeclarationleaders_sd_re_greens_theleft_5.pdf
declarationleaders_sd_re_greens_theleft_5.pdf
 
Indegene Limited IPO Detail - Divadhvik
Indegene Limited IPO Detail  - DivadhvikIndegene Limited IPO Detail  - Divadhvik
Indegene Limited IPO Detail - Divadhvik
 
Job-Oriеntеd Courses That Will Boost Your Career in 2024
Job-Oriеntеd Courses That Will Boost Your Career in 2024Job-Oriеntеd Courses That Will Boost Your Career in 2024
Job-Oriеntеd Courses That Will Boost Your Career in 2024
 
KING VISHNU BHAGWANON KA BHAGWAN PARAMATMONKA PARATOMIC PARAMANU KASARVAMANVA...
KING VISHNU BHAGWANON KA BHAGWAN PARAMATMONKA PARATOMIC PARAMANU KASARVAMANVA...KING VISHNU BHAGWANON KA BHAGWAN PARAMATMONKA PARATOMIC PARAMANU KASARVAMANVA...
KING VISHNU BHAGWANON KA BHAGWAN PARAMATMONKA PARATOMIC PARAMANU KASARVAMANVA...
 
422524114-Patriarchy-Kamla-Bhasin gg.pdf
422524114-Patriarchy-Kamla-Bhasin gg.pdf422524114-Patriarchy-Kamla-Bhasin gg.pdf
422524114-Patriarchy-Kamla-Bhasin gg.pdf
 
10052024_First India Newspaper Jaipur.pdf
10052024_First India Newspaper Jaipur.pdf10052024_First India Newspaper Jaipur.pdf
10052024_First India Newspaper Jaipur.pdf
 

Pioneer Dehradun-english-edition-2021-01-23

  • 1. C$;B;0C8DC4027 :8;;438=:´C0:01;0BC 1T]VP[dad):Pa]PcPZP2WXTU X]XbcTa1BHTSXhdaP__P^] 5aXSPhP]]^d]RTSP R^_T]bPcX^]^UC$[PZWTPRWc^ cWTZX]^UcW^bTfW^SXTSX] BWXeP^VVPQ[PbcP]S PbbTacTScWPcWXb 6^eTa]T]cfPbR^XccTSc^ bc^_P[[ X[[TVP[X]X]VX]cWTBcPcT C44==4?74F:8;;438= D?*A0?4BDB?42C43 2WXcaPZ^^c)0 $hTPa^[SVXa[ fPbWPRZTSc^STPcWfXcWP]PgT P[[TVTS[hPUcTaQTX]VaP_TSP]S WTaU^dahTPa^[S]T_WTfZX[[TS X]PeX[[PVTWTaT_^[XRTbPXS^] 5aXSPh0hTPa^[SP]Ua^ cWTVXa[³beX[[PVTWPb QTT]PaaTbcTSX] R^]]TRcX^]fXcWcWT RaXT 20?BD;4 A094B7:D0AQ =4F34;78 Two days after the Government offered to keep in abeyance the three farm laws, the rift widened between the Government and farmers’ unions on Friday. In the 11th round of meet- ing, farmer unions rejected the Government’s offer and insisted on complete repeal of the three laws. Both sides hardened their stands and could not even reach a decision on the date of the next meeting. In the very beginning of the meeting, farmer leaders said that they have decided to reject the proposal to put off farm laws for 18 months. Hardening its stand, the Government asked farmers’ unions that the next round of talks will only continue if they agree to accept the proposal by Saturday. Union Agriculture Minister Narendra Singh Tomar said the Centre has asked farmers to consider its proposal on the temporary suspension of the implemen- tation of the farm laws. The Minister added that the next meeting would be scheduled only after farmers’ unions come back with a response. He blamed external “forces” for their rigid stand and said no resolution is pos- sible when the sanctity of agi- tation is lost. Meanwhile, farmer leaders alleged even as the meeting lasted for nearly five hours, the two sides sat face to face for less than 20-25 minutes and for the rest of the time, they were in a separate rooms. Farmers’ lead- ers said they felt “insulted” by the manner in which the Ministers treated them. “The Minister made us wait for three and a half hours. This is an insult to farmers. When he came, he asked us to consider the Government’s pro- posal and said that he is end- ing the process of meetings,” said SS Pandher of Kisan Mazdoor Sangharsh Committee, adding that the agitation will continue peace- fully. At the meeting, the Union Ministers told farmers’ unions that they have been given all possible options and they must discuss internally the propos- al of suspending the laws. Sources said the Ministers were not happy with the farmers’ decision to continue their demand to hold tractor rally on Republic Day in Delhi. “The Government has given the best, solution-ori- ented proposal to farmer organisations. We asked them to reconsider our proposal as it is in the interest of farmers and the country. Talks remained inconclusive as farmers’ welfare was not at the heart of talks from the unions’ side. I am sad about it. Farmers’ unions said that they only want the repeal of the laws despite the Government asking for alter- natives. We should remain hopeful. We asked them to convey their decision tomor- row (Saturday). Let’s wait to hear farmer unions’ final deci- sion,” Tomar said after the meeting. Taking a hardline posi- tion, the Minister said some external force was definitely trying to ensure that the agita- tion continues and those were obviously against the interests of farmers. “The Government gave many proposals to end the protest, but no resolution is possible when the sanctity of an agitation is lost,” he said. Asked whether he expects farmers to agree to the Government offer, he said, “I don’t want to speculate, but we are hopeful that farmer unions will consider our proposal pos- itively.” On whether he saw any division among the union lead- ers on the Government pro- posal, Tomar did not give a direct reply but said, “We thanked all farmer leaders, including those who support our proposal and those who are against it.” During the meeting, farm- ers alleged the Delhi Police is trying to harass their leaders. One of the union leaders alleged that the rear wind- shield of his car was smashed by the Delhi Police. The car belongs to one Ruldu Singh Mansa. Darhsan Pal one of its leaders received a threatening phone call while Hannan Mollah was manhandled by police. As the 11th round of talks remained inconclusive, farmer leaders have threat- ened to intensify their protest. The break, during which farmer leaders had their langar (community kitchen) food, lasted for more than three hours. The break also saw 41 farmer leaders holding con- sultations among themselves, at times in smaller groups, while the three Union Ministers wait- ed in a separate room at Vigyan Bhawan. Farmer leader Shiv Kumar Kakka who was the first to leave the talks said there was no headway in the discussions and the Government asked unions to deliberate on its pro- posal again. After the meeting, Bharatiya Kisan Union (Ugrahan) leader Joginder Singh Ugrahan said the dis- cussions have broken down as the unions rejected the Government’s proposal. Harpal Singh, president of Bhartiya Kisan Union Asli Arajnaitik, said, “Even if we accept the Government’s offer, our fellow brothers sitting at Delhi borders will not accept anything other than a repeal of the laws. They will not spare us. What achievement will we show to them?” He also ques- tioned the Government’s cred- ibility, alleging it was difficult to believe that they will keep their word on putting the laws on hold for 18 months. 7Rc^aRc]VjdWRZ]`_^ZdXZgZ_Xd )DUPHUXQLRQVUHMHFW*RYW¶VSURSRVDOWRSXWIDUPODZVRQKROGLQVLVWRQUHSHDOQH[WWDONVGDWHQRWIL[HGDVULIWZLGHQV 5PaTa[TPSTabSdaX]VTTcX]VfXcWcWT2T]caP[6^eTa]T]c^]]TfUPa[PfbPcEXVhP]1WPeP]X]=Tf3T[WX^]5aXSPh 0? ?=BQ =4F34;78 While a section of health experts have raised ques- tions about the efficacy of the Hyderabad-based Bharat Biotech’s anti-Covid-19 vac- cine, Covaxin, a report in The Lancet Infectious Disease jour- nal has said the vaccine showed enhanced immune response without any serious side effects in the participants enrolled for the phase 1 trials. Bharat Biotech has devel- oped the vaccine in collabora- tion with the Indian Council of Medical Research (ICMR) and the National Institute of Virology (NIV), Pune. Covaxin has been granted emergency use authorisation (EUA) in clinical trial mode by the Government. Covaxin, which is now undergoing phase-3 trials, had raised concerns among experts over its emergency approval earlier this month by drug regulator DCGI. The vaccine, codenamed BBV152, was well tolerated in all dose groups with no vac- cine-related serious adverse events, noted the authors of the study funded by Bharat Biotech. The same results were ear- lier published in the preprint server medRxiv in December. However, there has been no new data released in the public domain which could demonstrate further safety and efficacy of the preventive. The authors said all adverse events were mild and moder- ate, and were more frequent after the first dose, adding that one adverse event was report- ed but was unrelated to the vac- cine. The randomised phase 1 trial to assess the safety and immunogenicity of BBV152 was carried at 11 hospitals across the country. Adults aged 18-55 years who were deemed healthy by the investigator were eligible. Between July 13 and 30, last year, 827 partici- pants were screened, of whom 375 were enrolled. Among the enrolled par- ticipants, 100 each were ran- domly assigned to the three vaccine groups, and 75 were randomly assigned to the con- trol group. Two intramuscular doses of vaccines were administered 14 days apart. “BBV152 led to tolerable safety outcomes and enhanced immune responses. The vaccine was well tolerated in all dose groups with no vac- cine-related serious adverse events,” the authors of the study said. RYD[LQHIIHFWLYHZLWKQR VLGHHIIHFWV/DQFHWVWXG ?=BQ =4F34;78 Aweek after the first dose of anti-coronavirus vaccines was given to front-line health workers, Prime Minister Narendra Modi on Friday interacted with those involved in the Covid-19 vaccination drive in Varanasi, his Lok Sabha constituency, and assured those anxious about the safety of the desi vaccines. Instilling confidence among those who were vacci- nated in the first phase of the vaccination drive in the coun- try, the PM said there are no major side-effects of the vac- cine and that India is absolute- ly self-reliant in regard to jabs. The beneficiaries said they have experienced no side effects, mental or physical. “If anything it feels like a normal injection,” they said. The Prime Minister, Ministers and other elected leaders or “key functionaries” are expected take shot of the vaccine in the second phase to boost the public confidence in the ongoing vaccination . The second phase of vac- cination would focus on the priority group above the age of 50 in the country. Of the two available vaccines — Civaxin or Covishield — every beneficia- ry will need to receive two doses of the same vaccine, 28 days apart. Addressing the beneficia- ries and those administrating the shots through video con- ference, Modi also expressed pride over the development of two vaccines in the country to tackle coronavirus pandemic. “The biggest vaccination programme in the world is going on in our country. Today, the nation has the willpower to manufacture its own vaccine - not one but two Made in India vaccines. Vaccines are reaching every corner of the country. India is absolutely self-reliant in this regard,” the PM said. Modi sought to dispel fears and misconceptions over the efficacy and safety of Covid vaccines in an interaction with health workers in Varanasi, his Lok Sabha constituency. “When doctors and health workers give a clean chit to the vaccine, it sends a very strong message among people about the efficacy of the jab,” he said. The PM said politicians or politics has no role in deciding the efficiency of the vaccine. RYLGMDEVHIILFDFLRXV VDIH30 GLVSHOVIHDUV ?=BQ =4F34;78 The Congress on Friday announced that the grand old party will have an elected president by this June. The schedule announced by the party’s working committee will ensure that the new president will escape responsibility for the outcome of the five State Assembly elections that will be held in May or before. After three and a half hours meeting, the CWC authorised incumbent interim party chief Sonia Gandhi to schedule the internal election after the con- clusion of Assembly polls in five States. Addressing a joint Press conference to brief details of the CWC, Congress leaders KC Venugopal and Randeep Surjewala said elections to the CWC will also be held, but it remains to be seen whether they can be scheduled before or after the election to the Congress chief’s post. AICC sources said the Central Election Authority has proposed the holding of polls for electing the party president and AICC session on May 29 and the working committee discussed the dates but autho- rised Sonia Gandhi to schedule them after the Assembly polls. The CWC passed three resolutions demanding a repeal of the three agriculture laws, a time-bound JPC probe into the alleged violations of national security and Official Secrets Act and another to ensure that the Government ensures free time-bound Covid-19 vacci- nation for the poor and oppressed sections. “The CWC decided that there will be an elected Congress president by June 2021 at any cost,” AICC general secretary KC Venugopal said. He said the little change in schedule depending on the State elections will be decided soon. “The CWC discussed the schedule of Congress presi- dent’s elections in May-end, proposed by its election author- ity. All CWC members unani- mously requested the Congress president that the internal elec- tions should not interfere with the Assembly elections.” He said the Congress pres- ident was requested unani- mously to reschedule AICC Plenary Session to the end of June 2021 and the Congress chief’s election would be con- cluded by June 2021. “We will conduct elections as per the Constitution of the party. We need a change of schedule due to Assembly polls as counting would be under- way in May,” he said. Asked about any dissenting notes on the holding of elec- tions, Surjewala said, “There was no dissent at the meeting.” 4`_Xe`XVeV]VTeVUTYZVWSj ;f_VRWeVc2ddV^S]ja`]]d ?=BQ =4F34;78 The CBI has registered a case against two UK-based firms — Global Science Research Limited (GSR), UK, represented by Dr Aleksandr Kogan and Cambridge Analytica, UK, represented by Alexander Nix — under IPC Sections relating to criminal conspiracy and cyber crime under the Information Technology Act for the alleged illegal harvesting of personal data of 5.62 lakh Indian Facebook users for commercial purposes. Earlier, a Preliminary Enquiry was conducted by CBI based on a complaint from Ministry of Electronics Information Technology. “It was revealed in the enquiry that the founder and director of first UK-based com- pany “Global Science Research Limited had allegedly created an app “this is your digital life” and this app was authorised to collect specific data of its users in Facebook (FB) as per their platform policy. It was alleged that the app illegally harvested additional data of FB users and of their friends on FB,” the CBI said in a statement. It was further alleged that 335 Indians had installed the app and data of approximate- ly 5.62 lakh FB friends of these users was harvested in unau- thorized manner by the app without their consent, the agency said. It was also alleged that the said company (Global Science Research Limited) entered into conspiracy with a second UK- based company (Cambridge Analytica) during 2014 and gave rights to use this illegally harvested data to the second company for commercial pur- pose, it said, adding that the investigation is continuing. 218Q^^Zb!D:UXabU^a WPaeTbcX]V51dbTab´SPcP B0D60AB4=6D?C0Q :;:0C0 Amid speculation that more politicians might join the BJP ranks during Union Home Minister Amit Shah’s January 31 rally in Howrah, another Bengal Minister Rajib Banerjee on Friday put in his papers holding out some “emotional details” before the media moments after tendering his resignation to Governor Jagdeep Dhankhar. Rajib is the third Minister to resign from the Mamata Banerjee Government in a month after Suvendu Adhikari and Laxmi Ratan Shukla. An hour later, Chief Minister Mamata Banerjee reportedly “removed” the Forest Minister from his posi- tion because there were some procedural lapses on his part in tendering his resignation. Sources at State Secretariat Nabanna said that he was being removed as he had tendered his resignation to the Governor instead of the Chief Minister who was his official appointee as the leader of the Cabinet. While the Trinamool Congress leadership promptly responded to the latest resig- nation drama saying a bucket of water taken out of the ocean would not matter much, besides raising some feeble corruption charges against the “just former” Minister who was yet to quit the party, Rajib said he had made up his mind to resign more than two years ago after the Chief Minister removed him unceremonious- ly as the Irrigation Minister. “Most regretfully I inform you that I have tendered my resignation from my office as Cabinet Minister being in charge of Forest Department,” an emotional Rajib Banerjee said. $QRWKHU0LQLVWHU TXLWV'LGL*RYW OLNHOWRMRLQ%-3 ?C8Q =4F34;78 Popular “bhajan” singer Narendra Chanchal, best known for his songs “Chalo bulawa aaya hai” and “Tune mujhe bulaya sherawaliye”, died following prolonged illness at a hospital here on Friday, sources in the hospital said. Chanchal, 76, breathed his last at 12:15 pm at the Apollo Hospital after suffering from brain complications, the sources said. The singer, who is survived by his wife Namrata, had been admitted to the south Delhi hospital on November 27, they said. Born to a Punjabi family in Namak Mandi, Amritsar, Chanchal’s growing up years in a religious atmosphere inspired him to start singing “bhajans” and “aartis” (devotional songs) from a very young age. In Hindi cinema, he found fame with the song “Beshak Mandir Masjid” for the 1973 film “Bobby”, the blockbuster debut of Rishi Kapoor and Dimple Kapadia. He won the Filmfare Best Male Playback Award in 1974 for the song. One of his most popular tracks was “Chalo Bulawa Aaya Hain Mata Ne Bulaya Hain” from Rajesh Khanna’s 1983 drama “Avtaar”. µ4YR]`Sf]RhRRRjR YRZ¶dZ_XVc?RcV_UcR 4YR_TYR]_`^`cV Noida (UP): Noida Police on Friday claimed to have busted an illegal kidney transplanta- tion racket involving foreigners and Indian citizens with the arrest of two persons, includ- ing a Bangladeshi citizen. The Bangladeshi national was allegedly being forced to donate his kidney and an Indian person had facilitated his travel and stay in the coun- try, the police said. An FIR was lodged against five persons at the Phase 3 police station following a com- plaint by the Gautam Buddh Nagar district health depart- ment, Deputy Commissioner of Police, Central Noida, Harish Chander said. “Some people were brought in from Bangladesh in exchange for financial benefits but were involved in kidney transplants. Two people have been arrested in connection with the racket,” Chander said. “We are investigating in detail how these foreigners were brought into the country and who else is involved in this racket. We are also verifying in detail the documents provided by these people,” the officer said. Those held have been iden- tified as Bangladeshi citizen Ahmed Sharif and Bazulhaq, a native of Siwan district in Bihar and currently living in Delhi’s Shaheen Bagh, police said. The others booked in the case included a man who was supposed to be getting the kidney harvested illegally from Sharif, a Bangladeshi travel agent Abdul Mannan, and one more person, they said. The FIR has been lodged under Indian Penal Code sec- tions 420 (cheating), 468 and 471 (all related to forgery of documents) besides the Foreigners Act, 1984, and the Transplantation of Human Organs and Tissues Act, 1994, police added. PTI :XS]ThcaP]b_[P]cPcX^]aPRZTc QdbcTSX]=^XSP1P]V[PSTbWX ]PcX^]P[P^]V!PaaTbcTS 6RQLDWRVFKHGXOH HOHFWLRQWRZRUNLQJ FRPPLWWHHDOVR /CWT3PX[h?X^]TTa UPRTQ^^ZR^SPX[h_X^]TTa 7`]]`hfd`_+ fffSPX[h_X^]TTaR^ X]bcPVaPR^SPX[h_X^]TTa ;PcT2Xch E^[ $8bbdT !! 0XaBdaRWPaVT4gcaPXU0__[XRPQ[T ?dQ[XbWTS5a^ 34;78;D2:=F 17?0;17D10=4BF0A A0=278A08?DA 270=3860A7 347A03D= 7H34A0103E890HF030 4bcPQ[XbWTS '%# 51,1R5HJQ877(1*5(*'1R8$'2''1 347A03D=B0CDA30H90=D0AH !!! *?064B !C! @A:?:@?' 8=CAD? C74HCADBC H@C=5) :00;070AA8B0BE824?A4B834=C5DAC74A 244=CBDB8=380A4;0C8=B78?)F7 m DA@CE# ;8E4A?;;B4 0C0=584;3 9=@?BD1D D?B19C5 F?935*415B ! F9F139DI m
  • 2. ]PcX^]! 347A03D=kB0CDA30H k90=D0AH !!! 3ULQWHGDQGSXEOLVKHGEKDQGDQ0LWUDIRUDQGRQEHKDOIRI0.3ULQWHFK/WG1R%HKLQG*XODE%KDZDQ %DKDGXU6KDK=DIDU0DUJ1HZ'HOKL 3KRQHRPPXQLFDWLRQ2IILFH)6HFWRU12,'$*DXWDP%XGK1DJDU83 3KRQH DQGSULQWHGDW-DJUDQ3UDNDVKDQ/WG '6HFWRU1RLGD83
  • 3. (GLWRUKDQGDQ0LWUD$,5685+$5*(RIC (DVWDOFXWWD1RUWK/HK:HVW0XPEDL $KPHGDEDG6RXWK%DQJDORUH KHQQDLHQWUDO.KDMXUDKR/XFNQRZ2IILFHWK)ORRU6DKDUD6KRSSLQJHQWUH)DL]DEDG5RDG/XFNQRZ7HOHSKRQHV $OWKRXJKHYHUSRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHOIRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULWRIRUELQGLQJLQDQZDRQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQUHVSRQVLELOLWIRUDQ GDPDJHRUORVVWRDQSHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQDFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULIDQGVHHNDSSURSULDWHDGYLFHWRVDWLVIWKHPVHOYHVDERXWWKHYHUDFLWRIDQNLQGRIDGYHUWLVHPHQWEHIRUH UHVSRQGLQJWRDQFRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQHPSORHHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQNLQGRIFODLPPDGHEWKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQNLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV BC055A4?AC4AQ =4F34;78 At least 266 fresh cases of Covid-19 reported in the national Capital on Friday while the daily positivity rate stayed at 0.37 per cent. According to the health bulletin issued by the Delhi Government, the total number of people infected with life- threatening COVID-19 has reached 633542. With this, the death toll rose to 10789 with seven new fatalities reported on Friday. The number of cases and the single-day fatality count now indicate a marked improvement in the situation since the third wave of the pan- demic had hit the city in November The highest single-day spike 8,593 cases till date was reported on November 11. The situation in Delhi has improved in the last several days, with a low number of cases and reduc- tion in death count, Besides fall in active cases, the count of home isolation cases have also registered a sus- tained fall, dropping to below 825-mark, indicating improve- ment in the COVID-19 situa- tion, as per the bulletin. These 266 new cases came out of the 71850 tests con- ducted the previous day, including 43105 RT-PCR tests and 28745 rapid antigen tests. According to the Tuesday bul- letin issued by the Delhi health department, out of the total number of 9068 beds in COVID hospitals, 8125 are vacant. It said that 125 beds in COVID care centres are occu- pied by persons under quar- antine, including travellers who have returned by the Vande Bharat Mission and bubble flights. BC055A4?AC4AQ =4F34;78 TheEconomicOffencesWing (EOW) of Delhi Police has arrested two men who con- vincedpeopletoinvestmoneyin their upcoming project in Bahadurgarh,Haryanabutfailed to allot the land to the victims. The accused persons iden- tified as Vijender Singh (52) and his associate Dalip Kumar (46), were arrested by the Economic Offences Wing of the Delhi Police on Thursday. Police said that Singh, a retired Indian Air Force employee started working as a property dealer along with Kumar who was already in the real estate business. According to Dr O P Mishra, the Joint Commissioner of Police, EOW, in 2015, the accused invited people to invest in an upcom- ing project Ganga City Colony through their firm Ganga Associates based in Dwarka. “After taking the amount from victims, neither did they hand over the possession of booked plots nor return the amount to the victims. The other directors in the company -- Ajay Kumar and Hemraj -- have already been arrested ear- lierinthecase,”saidtheJointCP. “The complainants alleged that the directors of Ganga Associates offered to sell plots in their upcoming project at Gubhana Kheri and assured them that all necessary approvals had been obtained from the authorities. Believing them, 24 people paid approxi- mately Rs 50 lakhs to the accused,” said the Joint CP. “Later, it emerged that the accused had not obtained the approvals for the project. A case was registered against the direc- tors of the company in 2018 and investigation was taken up by the EOW,” he said. “Investigationsrevealedthat SinghandKumarinconnivance with other directors lured peo- ple to invest money in their pro- ject, assuring allotment of plot but they failed to do so. It was also revealed that they did not have any land for the project at Gubhana Kheri. They had no permission from the District Town Planner to develop the project and had concealed the factthatthelandinquestionwas cultivableland,”saidtheJointCP. BC055A4?AC4AQ =4F34;78 The Delhi Police on Friday inducted 50 volunteers who will be its eyes and ears at the busy Sarojini Nagar market area to tackle terror threats ahead of Republic Day cele- bration in the National Capital. According to Ingit Pratap Singh, the Deputy Commissioner of Police (DCP), Southwest district, the volunteers in the police service programme are mostly shop- keepers and workers at the Sarojini Nagar market and will keep an eye on any suspicious activity. “In the eventuality of a ter- ror attack, the group would help other shopkeepers in evacuat- ing the market place. The vol- unteers know the corners of the market well and are familiar with the entry and exit points. They are also responsible for looking after the security dur- ing festivals, said the DCP. “The volunteers would be provided a jacket and a badge which would make it easy for the police to identify them during an emergency situation,” said the DCP. Sarojini Nagar is one of the most vulnerable places. There was a bomb blast there in 2005. The volunteers will patrol the market during peak hours with staff of Sarojini Nagar police station and will help in preventing pick-pocketing, bag lifting and petty thefts in the market. “They will keep a watch over the suspicious activities and will enhance a sense of security amongst the customers visiting the Sarojini Nagar Market. The antecedents of the volunteers were checked thoroughly before they were allowed to join the team,” the DCP added. BC055A4?AC4AQ =4F34;78 Delhi Chief Minister Arvind Kejriwal on Friday direct- ed the officials of Delhi State Industrial and Infrastructure Development Corporation Ltd (DSIIDC) to conclude all the developmental works in indus- trial areas including the first-of- its-kind business park in a time-bound manner. The direction came in a meeting convened by the Chief Minister with the officials of DSIIDC to review the devel- opment work on the new Rani Khera Technology Park, a new IT business park to be con- structed in Delhi. The DSIIDC officials gave a presentation to the chief minister on the con- struction work, which will commence from May 2021 onwards. The entire construction of the project should be complet- ed within the stipulated time- line. It should be done in a time-bound manner,” he said. Kejriwal also reviewed the status of the on-going mainte- nance works in the industrial areas of DSIIDC. The new deadlines of the on-going maintenance works have been set up by the departments due to the outbreak of COVID-19. Kejriwal directed the officials to complete the pending and on- going redevelopment and maintenance works in DSI- IDC industrial areas as per revised deadlines. Kejriwal also reviewed the status of the on-going mainte- nance works in the industrial areas of DSIIDC. Delhi Minister of Industries Satyendar Jain and other senior officials were also present in the meeting. In the meeting chaired by Kejriwal, the officials of the DSIIDC presented the detailed plan for the construction of the business park. The Delhi gov- ernment will develop this first- of-its-kind business park in seven different phases. The first phase of the Rani Khera Business Park development project is expected to be com- pleted by May 2023 and the second phase of the project is expected to be completed by May 2025. The chief minister was also apprised that all necessary approvals of the concerned government departments have been duly completed. 4`^a]VeVR]]T`_decfTeZ`_h`cdZ_Z_UfdecZR]RcVRd+V[cZhR] $c^bTaeTPb³ThTbTPab´^U_^[XRTPc BPa^YX]X=PVPaZcPWTPS^UA3Ph 'HOKLUHSRUWV IUHVKRYLGFDVHV Dg_`b_`UbdiTUQUbc XUTV_bTe`Y^W`U_`U CWTR^_[PX]P]cbP[[TVTS cWPccWTSXaTRc^ab^U6P]VP 0bb^RXPcTb^UUTaTSc^bT[[ _[^cbX]cWTXad_R^X]V _a^YTRcPc6dQWP]P:WTaX P]SPbbdaTScWTcWPcP[[ ]TRTbbPahP__a^eP[bWPS QTT]^QcPX]TSUa^cWT PdcW^aXcXTb1T[XTeX]V cWT!#_T^_[T_PXS P__a^gXPcT[hC$[PZWb c^cWTPRRdbTS BC055A4?AC4AQ 6DAD6A0 Acrime unit of the Gurugram Police have arrested four inter-State want- ed criminals who had looted Rs 10 lakh at gunpoint from a company employ- ee in Gurugram on January 11, the police said on Friday. The arrested accused were involved in three cases of loot and dacoity which they had committed in Gurugram and Delhi. The police have also recovered 2 motorcycles which were used in the crime. The culprits were identified as Shrawan alias Sikender (34) of Hisar, Sandeep (28), Suresh alias Bittu (38) and Surender alias Sonu (35) all residents of Jhajjar. The accused were arrested by the crime branch unit Sector-17 led by Inspector Narender Chauhan from Sector-14 on Thursday after a tip-off. During interrogation the accused revealed that they used to stand outside the bank and keep vigil on people who came outside alone with bag later they followed them on their bike and robbed them on gun point. As of now the accused have robbed Rs 28 lakh in three instances, said Preet Pal Sangwan, ACP (crime). On January 11, Deepak Pandey, who was working with a private firm located in Udyog Vihar Phase- 1 was robbed at Atul Kataria chowk by the three arrested criminals on gun point. Panday had withdrawn Rs 10 lakh from a private bank located in sector- 14 and was going to his company on his scooty when the incident took place. An FIR under relevant sections of the IPC had been lodged against three unidentified robbers at the Palam Vihar police station. BC055A4?AC4AQ =4F34;78 Following the directions from a court, the Delhi Police has registered a cheating case against Shiromani Akali Dal leader and Delhi Sikh Gurdwara Management Committee (DSGMC) president Manjinder Singh Sirsa. In November last year, a Delhi court had directed the Economic Offences Wing (EOW) of Delhi Police to register an First Information Report (FIR) against Sirsa for alleged misap- propriation of funds during his tenure as the secretary general of the DSGMC. According to a senior police official, the case against Sirsa and others was registered on Thursday for cheat- ing and embezzlement of gurdwara funds by making huge unjustified payments, totalling around Rs 1 crore, for the purchase of tents, blankets and tarpaulin from sham companies. “It was registered on the basis of a com- plaint by one Bhupinder Singh, who is one of the stakeholders in the funds received by the DSGMC,” said the senior police official. 2WTPcX]VRPbTPVPX]bc 6daSfPaP2^XccTT _aTbXST]cBXabP #RaXX]P[bfW^a^QQTSC ; PcVd]_^X]cX]6³VaPWT[S CWT_^[XRTWPeTP[b^aTR^eTaTS! ^c^aRhR[TbfWXRWfTaT dbTSX]cWTRaXT ?=BQ 347A03D= SIIDCUL Entrepreneur Welfare Society Pantnagar organised road safety month at SIIDCUL fire station in Udham Singh Nagar district. Representatives of almost all the industries participated in the programme. ARTO Vipin Kumar gave a detailed lecture on road safety. He said the traf- fic rules and guidelines are made for the benefit and safe- ty of common citizens. SIIDCUL Association’s President Manoj Tyagi dis- closed that series of pro- grammes linked to road safety will be organised throughout the month. He said there was nothing precious then life asserting that a large number of lives are lost every year in road mishaps. Fire services officer Udham Singh Nagar Vansh Yadav informed the gathering about the impor- tance of safety in one’s life. He said strictly adhering to safety rules helps one save himself from road accidents. 5RDG6DIHW0RQWK DW6,,'8/ NEW DELHI: All 12 samples of dead cranes in the Delhi zoo have tested negative for bird flu, authorities said on Friday, a week after the first case of avian influenza was detected in its premises. “Four cranes were found dead in the Delhi zoo a few days ago. Twelve samples were collected on Monday and sent to National Institute of High Security Animal Diseases (NIHSAD) of Indian Council of Agricultural Research for testing, Bhopal,” Dr. Rakesh Singh, the director of the ani- mal husbandry unit of the Delhi government, said. All the 12 samples have tested negative, he said. Last week, samples from a dead owl in the Delhi zoo had tested positive for avian influenza. Zoo Director Ramesh Pandey said they were follow- ing all protocols and monitor- ing the situation strictly. We have been using the ebird mobile application to keep track of the birds in the premises of the zoo, he said. This is the first time the application is being used for bird monitoring and record keeping during the outbreak of avian influenza. The application allows the user to enter sightings from anywhere in the world, even in areas with no cell service, or Internet access. Singh said that 1,338 bird deaths have been reported in Delhi between January 6 and January 21 amid the bird flu situation. BP_[Tb^USTPSRaP]TbX]3T[WXi^^cTbceTU^aQXaSU[d Gurugram: Two men includ- ing a juvenile have been detained for the murder of a 65-year-old woman in Gurugram's Sohna area, the police said, adding that the crime reportedly took place on Friday morning. According to the police, the investigation team have detained the culprits involved in the crime and are question- ing them. Names of the accused will be disclosed after detailed investigation. Police said the victim's body, which was lying on the floor, was first noticed by her domestic help inside her house at Kayastha wada colony of Sohna in Gurugram on Friday morning at around 5 a.m. Her head had been slashed brutal- ly with some blunt object and her entire house was ransacked. IANS Y^SeTY^WZefU^YU TUdQY^UTV_b[YY^W UTUbig_]Q^
  • 4. RP_XcP[ 347A03D=kB0CDA30H k90=D0AH !!! ?=BQ 347A03D= Considering the situations caused by Covid-19 and to expedite the remaining works for the Kumbh Mela 2021 in Haridwar, the State Cabinet has approved four decisions in its meeting held on Friday. Informing the media about these decisions, Cabinet Minister and State Government spokesman Madan Kaushik said that the decision taken by the Chief Minister Trivendra Singh Rawat to authorise the Kumbh Mela officer and Garhwal commissioner to approve works costing upto Rs two crore and Rs five crore respectively was approved by the cabinet. The cabinet also decided to grant the Kumbh Mela officer the authority to increase approved works by 50 per cent. In addition to this, the cabinet also granted its approval to make the tender process period seven days and to split work projects in two parts. Kaushik informed that a total of 15 decisions were taken by the cabinet in its meeting. He informed that there are 155 teachers in the Sanskrit Education department teaching at various levels from school to college. For teachers in man- agerial positions and who have been teaching continuously for five years the cabinet approved Rs 15,000 per month, Rs 25,000 per month for teachers who have been teaching for five to 10 years and Rs 30,000 per month for teachers who have been teaching for more than 10 years. Further, according to University Grants Commission standards, any of these teach- ers who have done MPhil or PHd will be paid an addition- al Rs 5,000 allowance. The cabinet also approved 0.206 hectare land at Ranikhet in Chaukhutia block of Almora district for establishing a Kendriya Vidyalaya. Kaushik further informed that 22,492 pre-matric scheduled caste stu- dents got less scholarship amount during 2017-18 and 2018-19 as the funds were not received. The cabinet approved Rs 3.79 crore from the State budget to pay the remaining scholarship amount to these students. Similarly, a sum of Rs 4.36 crore was approved to pay the remaining scholarship amount to about 20,000 other backward classes students. The cabinet also approved the cre- ation of six technical posts in the engineering wing of the Uttarakhand Tourism Development Board. The Uttarakhand drug control ser- vice manual was also promul- gated. The minister further informed that from the list of 21 organisations working as executing agencies for various state government departments, the cabinet approved the removal of Uttar Pradesh Rajkiya Nirman Nigam and the Uttar Pradesh Samaj Kalyan Nirman Nigam. Further, the work capacity of the Rural Engineering Services has been increased from Rs five crore to Rs 15 crore. In another deci- sion, the cabinet gave its approval to the firm CAMP to operate 132 of the 140 ambu- lances handed over to the state during the Covid pandemic. The operation of the ambu- lances which will also be used during the Kumbh Mela was handed over as per the 2018 rates. In addition to this, the cabinet also approved alloca- tion of 4.384 hectare land of the irrigation department in Haridwar to facilitate Bhu Samadhi for deceased mem- bers of the religious fraternity. 4RSZ_Ve_`Ue`UVTZdZ`_de`ViaVUZeV cV^RZ_Z_Xf^SYV]Rh`cd ?=BQ 347A03D= The Covid-19 contagion is fast diminishing from the state of Uttarakhand. The new cases of the disease are now concentrated in the three dis- tricts of Dehradun, Haridwar and Nainital. On Friday ten out of 13 districts of the state reported less than five new cases of the disease. Three dis- tricts reported no case on the day. Meanwhile the number of novel Coronavirus (Covid-19) cases in Uttarakhand increased to 95464 on Friday with the state health department 110 new cases of the disease. The department also reported the death of three patients on Friday which increased the death tally to 1629 in the state. The health authorities discharged 183 patients from different hospi- tals of the state following their recovery on the day. A total of 90730 patients have so far recovered from the disease. The recovery percentage in the state now stands at 94.04 and the sample positivity rate is 4.67 percent. Two patients of the disease were reported dead at Sushila Tiwari government hospital Haldwani on the Friday while one patient succumbed to the disease at Government Doon Medical College (GDMC) hos- pital. Out of 183 patients recovered on the day, 72 were from Dehradun while 48 were from Nainital. The state health depart- ment reported 54 new patients of the disease from Dehradun, 29 from Nainital, 13 from Haridwar, four from Udham Singh Nagar, three from Rudraprayag, two each from Champawat and Pithoragarh, one each from Chamoli, Bageshwar and Tehri districts. No new patient of Covid-19 was detected in Almora, Pauri and Uttarkashi districts on the day. Uttarakhand now has 1795 active cases of the disease. Dehradun is at continuing to remain at top of the table of active cases with 424 cases while with 311 active cases Nainital is at second spot. Haridwar is at third position with 245 cases, Almora has 133, Bageshwar 129, Udham Singh Nagar 125, Chamoli 88, Tehri 87, Pithoragarh 82, Uttarkashi 75, Pauri 55 and Rudraprayag 36 active cases of the disease. With only five active cases of Covid-19, Champawat is at the bottom of the table. ?=BQ 347A03D= Notwithstanding the decline in enthusiasm among the health workers, the vaccination drive in the state is continuing with planned regularity. On Friday a total of 2308 health workers were vaccinated in 35 vaccine sessions held in all the 13 districts of the state. The chief operations officer (COO) of the state Covid-19 control room, Dr Abhishek Tripathi said that 171 vaccine sessions have so far been held in the state and in them 10514 health work- ers have received the first dose of the vaccine. On Friday five vaccine sessions were held in Dehradun district and in them 440 workers were vaccinated. In Udham Singh Nagar 241 health workers received the jab of the vaccine in four vaccine sessions. In Almora 118 workers were vaccinated on the day. Similarly 96 health workers in Bageshwar, 183 in Chamoli, 165 in Champawat, 190 in Haridwar, 230 in Nainital, 125 in Pauri, 100 in Pithoragarh, 155 in Rudraprayag, 143 in Tehri and 122 in Uttarkashi were vacci- nated on the day. The second dose of the vaccine would be adminis- tered to these recipients on 28th day of the first dose. The health department has direct- ed the Chief Medical Officers (CMO) to ensure that the sec- ond dose of vaccine is kept safe for the beneficiaries. The state has so far received two con- signments of the Covishield vaccines. In the first lot, 113000 doses were sent to the state while in the second 92500 doses were received. The Covishield vaccine is developed by Oxford University- AstraZeneca and manufac- tured in India by Serum Institute of India (SII). ?=BQ 347A03D= Aworkshop titled 'Pressure Injury Evidence Based Nursing Approach' was orga- nized by the Department of Nursing Services in All India Institute of Medical Sciences (AIIMS) Rishikesh on Friday. In the workshop, the partici- pants were given detailed infor- mation about the immediate identification, prevention and treatment of pressure injury. Addressing the workshop the Director of AIIMS Rishikesh Ravi Kant, said that the institute strives to bring international level of efficien- cy in pressure engineering management. He said that after taking experience from AIIMS Rishikesh, nurses will provide better nursing services not only in the country but also out of the country. The Dean Academics of the institute, Professor Manoj Gupta said that nursing staff have an important role in pres- sure injury management and treatment in the hospital. Professor UB Mishra informed the participants about the his- tory of pressure injury. Giving various examples, he gave information about the changes coming in this direction. In the workshop Dr Rajalakshmi Iyer gave information about the pressure injury overview while Dr Madhubari Vathulya of the Department of Burn and Plastic Surgery, spoke about the grade classification of pres- sure injury. ?=BQ 347A03D= Uttarakhand chief minister Trivendra Singh Rawat inaugurated the state's first child-friendly police station unit in the premises of Dalanwala police station in Dehradun on Friday. Addressing the gathering, Chief minister stated that this initiative will provide friendly and unintimidating environ- ment to children who are either victims or involved in the juve- nile delinquency. Rawat assert- ed that children should be introduced to police as their friends and protectors rather than someone they should be scared off. Moreover, CM also announced to set up a revolv- ing fund of Rs one crore on the request of the SCPCR chief Usha Negi for child protection and welfare programmes across the State. Earlier, Usha Negi from State Commission for Protection of Child Rights (SCPCR) also stated that con- sidering the hike in juvenile crimes in recent years, the establishment of child-friend- ly police station will help chil- dren to have an open interac- tion with authorities without being intimidated. As the next step in this initiative, all the dis- tricts will have their own child- friendly police station which will be established with the help of the police department. For the establishment of child- friendly police stations in 13 districts of the State, the child commission will issue Rs 13 lakh to the police department soon, informed Negi. Meanwhile, the director- general of police (DGP) Ashok Kumar said that the police always make efforts to make every police station child and woman friendly. Moreover, Kumar said that about 2200 child beggars were marked under operation Mukti and now most of these children are getting school education. He asserted that people should support children, especially child beggars by taking their responsibility and directing them towards education to make them independent rather than giving them some money which does no good to them in the long run. Moreover, mayor Sunil Uniyal 'Gama', Rajpur MLA, Khajan Das, DIG Garhwal Neetu Garg, and the head of State Women Commission Vijaya Barthwal were also present in the event. ?=BQ 347A03D= Aviral video in which two persons said to be the for- mer employees of Khanpur MLA, Kunwar Pranav Singh Champion are seen accusing the MLA for threatening them has given a chance to the opposition Congress party to attack the government. The spokesper- son of Uttarakhand Congress and member of All India Congress Committee (AICC), Garima Dasauni said on Friday that the allegations levelled against the BJP MLA in the video are shocking and put up a question mark over the state police which is keeping quiet on the issue. She said that the silence of the chief minister and the government on the issue shows that the BJP is protecting its MLA. Terming Champion as synonym of controversies, the Congress leader said that prima facie the allegation levelled by the former employees of the MLA are of serious nature and the police and state adminis- tration should take immediate note of the issue. ?0A8CB7:8C78 As some experts have been stating openly for some years now, information and the manner in which it is used is the most powerful tool to influ- ence minds and actions of the people. One could even argue that information is more pow- erful than even the most destructive conventional weapons as the decision to use such weapons is based on information. Though many nations cannot drop out of the race to enhance their armed forces further, most have devel- oped their own ways to capi- talise on the power of infor- mation and the effect of disin- formation. Conspiracy theories are one phenomenon that appear to have grown in influence in recent years. A conspiracy the- ory is considered to be a theo- ry that explains a set of cir- cumstances or an event as something brought about by a secret plot usually by powerful conspirators. They range from fantastic sounding ideas like ‘lizard people’ living among us and controlling politics to one of the comparatively recent theory –QAnon which basi- cally centered around the idea of the previous US president Donald Trump waging a secret battle versus elite Satanist pae- dophiles in government, busi- ness and the media. Not all conspiracy theories are untrue like the one about the CIA con- ducting mind control experi- ments on unaware citizens during the 1950s and 60s which was later found to be correct. However, whereas some con- spiracy theories may bring about negligible changes in the people who believe in them, others may have a more serious impact. The followers of QAnon were among those leading the recent storming of the Capitol Hill in the USA apart from being involved in disturbances which also saw followers of other such fuelled agitations. The influence such ideas have can be gauged from the fact that they have follow- ers in various countries includ- ing India. Such theories have created a global fraternity of people who also believe that the latest viral pandemic is a con- spiracy too. A neuroscientist or psychiatrist can explain aspects like the tendency to view pat- terns where none exist, the nat- urally higher levels of dopamine and the proclivity for confirmation bias in people who tend to be strong believ- ers even in unfounded con- spiracy theories. Some con- spiracy theorists cleverly mix credible facts with illogical fac- toids, which makes one wonder whether such theories are per- petuated by people actually wanting to conceal the uncom- fortable facts by mixing them with fantastic contents to dis- credit the whole mixture. Whatever the case be, the real- ity being faced regularly is the repercussions of disinforma- tion and calculated moves influencing people in ways that are not really desirable. Take the example of the agita- tion being carried out against the farm laws. If one digs even a bit without bias into the issue, the past and ideological evidence related to some of 2^eXSePRRX]PcX^] KHDOWKZRUNHUV YDFFLQDWHGRQ)ULGD 0c^cP[^U ePRRX]T bTbbX^]bWPeTb^UPaWT[SX] cWTbcPcTP]SX]cWT $ # WTP[cWf^aZTabWPeTaTRTXeTS UXabcS^bT^U2^eXbWXT[S 3_fYTSQcUcTUSbUQcY^W bQ`YTiY^EddQbQ[XQ^T CWaTTSTPcWb ]Tf_PcXT]cb aT_^acTS^]5aXSPh =^_PcXT]c STcTRcTSX] 0[^aP?PdaXP]S DccPaZPbWXSXbcaXRcb C74C74AB834 2IFRQVSLUDFWKHRULHVDQGPRGLILHGIDFWRLGV F^aZbW^_^] _aTbbdaTX]Ydah WT[SPc088BA 8]cWTeXaP[eXST^ cf^Qa^cWTabQ[PT :WP]_da;0U^a cWaTPcT]X]VcWT ?=BQ 347A03D= Even after the instructions of the Municipal Corporation of Dehradun (MCD) to provide the list of those who do not dis- pose of domestic garbage through the door to door garbage collection service, the Ramky Enviro Engineers Limited (REEL) has failed to provide the list for over two months. Despite the door to door service provided by the corporation in most of the wards, the domestic garbage is mostly found dumped on road- side areas of the city. Taking strict action against the issue, MCDaskedREELthatmanages the sanitation facility in 69 wards to provide the list of those households which do not dispose of garbage in these wards. The senior municipal health officer Dr R K Singh had stated that they would issue notices to such households and impose penalties under anti-lit- tering act as soon as they would receive the list. However, the officials in MCD are still wait- ing for the list for over two months. Since the corporation will start 100 percent door to door garbage collection service in all 100 wards from the next month, the officials are focusing to improve the service in the old wards too, especially due to Swachh Survekshan 2021. Talking about this, the chief municipal health officer Dr Kailash Joshi said that the cor- porationhadaskedREELtopre- pare the list of all such house- holds that do not dump garbage in the door to door collection service but the corporation has received no list so far. He said that MCD has sent a notice to thecompanyregardingthedelay andhasinstructedtoprovidethe list as soon as possible. 23PbZbA44;c^_a^eXST[Xbc ^UW^dbTW^[SbcWPcUPX[c^Sd_ VPaQPVTX]S^^ac^S^^abTaeXRT ?=BQ 347A03D= The troupe representing Uttarakhandpresentedacul- tural performance in traditional attire as part of the Rashtriya Rangshala Camp organised by theDefenceministryaheadofthe RepublicDaycelebrationinNew Delhi. The troupe from Uttarakhand was among the representatives from 17 states who performed along with the tableaux of their states. It is worth mentioning here that headed by the State infor- mationdepartmentdeputydirec- tor KS Chauhan, a 12-member troupe is performing as part of Uttarakhand’s tableau in the Republic Day parade in the nationalcapital.Thethemeofthe state’s tableau is Kedarkhand. Modelsofthestateanimal-musk deer, state bird Monal pheasant and the state flower Brahmakamal have been dis- playedonthefrontofthetableau. Themiddleportionofthetableau displays a model of the sacred bull Nandi facing a model of the Kedarnathtemple.Pilgrimshave also been shown going towards Kedarnath in the tableau. D´ZWP]ScPQ[TPdT[XRXcb_aPXbT X]APbWcaXhPAP]VbWP[P2P_ ?=BQ 347A03D= Deepak Joshi was re-elected on the prestigious position of the President of the Uttarakhand secretariat asso- ciation on Friday. In a keenly contested election, he defeated his nearest rival Narendra Prasad Raturi by nine votes. Joshi received 492 votes while Raturi got 483. Third contes- tant Balwant Singh Jyada was able to receive only 27 votes. Vimal Joshi was elected secre- tary in the election. He got 317 votes while Rakesh Chandra Joshi and Pradip Papne got 279 and 225 votes respectively. In these elections, Sunil Kumar Lakhera won the post of vice president of the association. The term of the new executive body would be two years. 9^bWXaTT[TRcTS _aTbXST]c^U bTRaTcPaXPcQ^Sh 3TUTPcb=? APcdaXX]P R[^bTR^]cTbc 8]eTbcXVPcT2WP_X^]beXST^)2^]VaTbbc^6^ec those leading the movement, a person’s opinion will surely be affected. Of course, one can also find things to criticise about the government, other politicians and tycoons but some rich people pretending to be poor and directing others to oppose some other rich people for making money is highly questionable to say the least. Whether one likes it or not, it is a common human tendency to blame other people or forces beyond our control for our own problems. However, when such blame is illogical, it will not lead to anything fruit- ful. The government is doing its bit to tack- le this, at times suc- cessfully, sometimes with delayed results and sometimes unsuccessfully. What remains to be seen is whether we also become alert and go beyond conspiracy theories and modified factoids. 2bTcbd_aTe^[eX]VUd]SU^aRWX[S_a^cTRcX^]P]SfT[UPaT ?=BQ 347A03D= Action will be taken to resolve the issues being faced by the Tehri dam dis- placed persons within two months. This decision was taken in the meeting of Union Minister of State for Power, Rajkumar Singh with the del- egation from Uttarakhand led by the state’s Irrigation Minister Satpal Maharaj in New Delhi on Friday. It was decided in the meet- ing that the 415 Tehri dam dis- placed families not yet reha- bilitated will be provided land or fund. Agreement was reached on most issues and it was decided that the problems will be resolved in two months. The government of India power secretary and Uttarakhand irrigation secre- tary have been directed for val- uation of the land of the dis- placed. Putting to rest specu- lation about shifting of the headquarters of THDC India Limited, Singh said that the headquarters will remain in Rishikesh. It was also decided that a policy will be prepared for periodic transfer and pro- motion of the THDCIL staff. Further, a committee will be formed soon to facilitate free sewer and water along with electricity at half rates for the Tehri dam displaced. It was also decided that seven boats and two buses will be operated for the Pratapnagar area affected by the dam. It was also decid- ed in the meeting that 21 hectare land available with THDCIL will be returned to the eligible dam displaced. All the court cases filed by THD- CIL in this regard will also be withdrawn. Maharaj later informed that the meeting with the Union minister was quite fruit- ful. Singh listened to the prob- lems of the dam displaced seri- ously and also spoke of resolv- ing their issues outside the court. The Tehri MLA Dhan Singh Negi appreciated the decision taken to resolve the problems of the dam displaced people within two months. 3UREOHPVRI7HKULGDPGLVSODFHGWR EHVROYHGLQPRQWKV8QLRQ0LQ
  • 5. ]PcX^]# 347A03D=kB0CDA30H k90=D0AH !!! ?=BQ =4F34;78 Over 2.28 lakh healthcare workers and frontline workers received the Covid-19 vaccine shots across the States on Friday, the seventh day of the mega immunisation exer- cise that was launched on January 16 in the country. It took the total tally of people who have been given the vac- cine to 12,72,097. “The Covid-19 vaccina- tion programme was conduct- ed successfully on the seventh day of the countrywide massive exercise. The cumulative num- ber of healthcare workers vac- cinated has surpassed 12.7 lakh (12,72,097) (till 6 p.m. today) through 24,397 sessions, as per the provisional report,” the Union Health Ministry said in a statement. A total of 267 cases of Adverse Effect After Vaccination (AEFI) have been reported till 6 pm on the sev- enth day of the vaccination drive. On Friday, 2,28,563 bene- ficiaries were vaccinated till 6 p.m. through 6,230 sessions. On Thursday, 1,92,581 people were vaccinated and 1,12,007 a day before. In Karnataka, 1,82,503 have been vaccinated so far, highest amongst all states, followed by 1,27,726 in Andhra Pradesh, 1,21,004 in Odisha and 1,02,724 in Telangana, according to the data available from the Government. On the testing front too, India continues to register growing numbers. The cumu- lative testing has crossed 19 Crore, said a statement from the Union Health Ministry with 8,00,242 samples tested in the last 24 hours itself. The Ministry also said that steadily following the trend set over the past weeks, India’s active caseload has fallen to 1.78% of the total active cases. India’s active caseload presently stands at 1,88,688. 18,002 new recoveries were registered during the past 24 hours. This has led to a net decline of 3,620 cases from the total Active Caseload in the last 24 hours. The total recovered cases are 10,283,708 as on Thursday pushing the growing gap between the recovered and the active cases to 1,00,95,020 ( 54.5 times). The Recovery Rate has improved to 96.78%. Around 85 per cent of the new recovered cases are con- tributed by ten States/UTs with Kerala reporting 6,229 persons recovering from the infection. Maharashtra and Karnataka reported 3,980 and 815 new recoveries, respec- tively. At least 14,545 new posi- tive cases were registered in the last 24 hours. Eight States/UTs have contributed 84.14 per cent of the new cases. Kerala reported 6,334 cases in the last 24 hours. Maharashtra record- ed 2,886 new cases while Karnataka registered 674 daily cases on Wednesday. As many as 82.82 per cent of the 163 case fatalities that have been reported in the past 24 hours are from Nine States/UTs with Maharashtra reported the maximum new daily deaths at 52. Kerala also saw a fatality count of 21, as per the statement. @gVc#=XVedY`edd`WRc,##)=`_7cZ ?=BQ =4F34;78 Bharat Biotech has suc- cessfully administered the second dose of its COVID-19 vaccine Covaxin to 13,000 volunteers as part of its ongo- ing phase-3 clinical trials of the jab, Suchitra Ella joint managing director of Bharat Biotech said on Friday. She said in a tweet, “13,000 volunteers have been successfully administered the 2nd dose in the phase-3 clin- ical trials of Covaxin. My heartfelt thanks to all of them for their pro-vaccine public health voluntarism. The city-based vaccine maker has successfully com- pleted enrollment of25,800 volunteers for the Phase-3 tri- als of Covaxin, Ella had ear- lier said. The DCGI has granted permission for the sale or dis- tribution of Covaxin for restricted use in emergency situations in public interest as an abundant precaution, in clinical trial mode. The vaccine-maker in the fact sheet on Covaxin, post- ed in its website, had said the clinical efficacy of the vaccine is yet to be estab- lished and is being studied in Phase 3 clinical trial and hence it is important to appreciate that receiving the vaccine does not mean other precautions related to COVID-19 need not be fol- lowed. Covaxin is India’s totally indigenous COVID-19 vac- cine developed in collabora- tion with the Indian Council of Medical Research and National Institute of Virology. The inactivated vaccine is developed and manufactured in Bharat Biotech’s BSL-3 (Bio-Safety Level 3) bio-con- tainment facility, one of its kind in the world. :aTRTXeTbTR^]SS^bT^U 2^ePgX]X]?WPbTcaXP[b New Delhi: The Centre on Friday told the Supreme Court that it was not in favour of granting one extra opportuni- ty to those civil services aspi- rants who could not appear in their last attempt in the exams conducted by the UPSC last year due to the COVID-19 pandemic. A bench headed by Justice A M Khanwilkar took note of the submissions of Additional Solicitor General S V Raju, appearing on behalf of the Department of Personnel and Training (DoPT). “We are not ready to give one more chance. Give me the time to file an affidavit... last night I received instruction that we are not agreeable,” Raju told the bench, which also comprised justices B R Gavai and Krishna Murai. The bench has now post- ed the plea of a civil services aspirant Rachna Singh for hearing on January 25 and asked the Centre to file an affidavit during the period and serve it to the parties. E a r l i e r , S o l i c i t o r General Tushar Mehta had told the bench that the government was considering the issue of granting one more opportu- nity to those civil services aspirants who could not appear in their last attempt to crack the UPSC exam. The top court, on September 30 last year, had refused to postpone the UPSC civil services preliminary exam, which was held on October 4, because of COVID- 19 pandemic and floods in several parts of the country. However, it had directed the Central Government and the Union Public Service Commission to consider granting an extra chance to candidates who otherwise have their last attempt in 2020, with corresponding extension of the upper age-limit. The bench was then told that a for- mal decision can be taken by the Department of Personnel and Training (DoPT) only. PTI 2T]caT]^cX]UPe^da^U VXeX]VTgcaPRWP]RTc^ D?B2Pb_XaP]cbB2c^[S ?C8Q =4F34;78 The Centre has accorded the top category ‘Z+’ VIP security cover to former Chief Justice of India (CJI) Ranjan Gogoi, official sources said on Friday. They said Gogoi, 66, will be protected by armed comman- dos of the Central Reserve Police Force (CRPF) during his travel all across the country. A Rajya Sabha member now, Gogoi was earlier being provided with a security cover of Delhi Police He retired in November, 2019 and was later nominated to the upper house of Parliament by the Government. The CRPF has a VIP secu- rity unit and Gogoi is its 63rd protectee, sources said. 4G2986^V^X VTcbIE8? bTRdaXchR^eTa ?=BQ =4F34;78 The Enforcement Directorate (ED) on Friday attached assets worth C5.45 crore of Ramanand Divya, for- mer Chief Engineer, Water Resources Department, Chhattisgarh and his family members under money laun- dering charges. The attached assets are in the form of agriculture land and plots in Raipur, Bilaspur, Korba and Janjgir-Champa dis- tricts and bank balances to the tune of C55.95 lakhs held by the accused Ramanand Divya and his family members. The ED had initiated inves- tigation under Prevention of Money Laundering Act (PMLA) on the basis of FIR registered by ACB, Chhattisgarh under relevant section of Prevention of Corruption Act which dis- closed the disproportionate assets to the tune of C5.45 crore amassed by Divya and his family members. “Investigation under PMLA revealed that most of the immovable properties were purchased in the name of Priyadarshini Divya wife of Ramanand Divya, few being in the name of accused Ramanand Divya himself as well. The properties were acquired through various ways of money laundering. In few cases, property was purchased directly in cash or through cash deposits in bank accounts of self as well as other relatives,” the ED said in a statement. In some cases, routing of funds was done through accounts of relatives and per- sons with meagre sources of income in the form of gift or unsecured loan. For purchasing some properties, fake sale agree- ments of other properties show- ing receipt in cash were also pre- pared, to project the source of cash as untainted, it said. Also, there were frequent sale and purchase of properties to project the source of money for purchase as genuine where- as the very source of initial pur- chase was unexplained and tainted money, it further said. Investigation further revealed that C2.13 crore was paid in cash for purchase of properties. 43PccPRWTb TgRWXTUT]VX]TTa´b C$#$RaPbbTcb 0A270=09HC8Q=4F34;78 Raising hopes, scientists of the School of Biochemical Engineering of IIT-BHU in col- laboration with the Institute of Medical Sciences, BHU have test- ed a vaccine that halts the progress of the Kala Azar, a neglected trop- ical disease caused by Leishmania parasite. Currently there is no vaccine yet available in the market for humans against this disease and the treatment depends on drugs with limitations which is a serious con- cern towards its complete elimina- tion. In India which has postponed Kala Azar disease elimination goal thrice with 2025 new deadline, 54 districts in Bihar, Jharkhand, Uttar Pradesh, and West Bengal are still affected by the disease with spo- radic cases in other states like Assam, Himachal Pradesh, Kerala, Sikkim, and Uttarakhand. The scientists including Prof Vikash Kumar Dubey of the School of Biochemical Engineering and Prof Shyam Sundar of the depart- ment of medicine, IMS, investigat- ed and tested the new recombinant vaccine on the mice infected with the disease. Dr Sunita Yadav, a National Postdoctoral Fellow and Prof Dubey who are investigator in the study said that the prophylactic potential of this vaccine was eval- uated in preclinical studies in mice model that showed a signif- icant reduction in parasite load in liver and spleen organs of vacci- nated infected mice than infected control mice. The research has been recently reported in the pres- tigious journal “Cellular Immunology”. “Clearance of the parasite bur- den in vaccinated challenged mice is correlated with immune response expected in a vaccine candidate,” said Professor Vikash Kumar Dubey. It is a type of defence mechanism that happens in our body after vaccination and helpful for prevention of disease progression. He said this study provides insight towards the evaluation of vaccine molecules against Leishmania infection. In future, it might be utilised as a vaccine can- didate against the pathogen. However, more study is needed to better understand its mode of action. The team next plans to fur- ther evaluate its potential in other clinical trials. As of November 2020, 12 blocks in Jharkhand and 4 blocks in Bihar reported more than 1 case of Kala Azar per 10,000 popula- tion. Uttar Pradesh and West Bengal have also managed to sig- nificantly achieve their elimination target. Kala Azar is the 2nd largest par- asitic killer in the world after Malaria and results in a 95 percent fatality rate if the patients are not treated. Additionally, up to 20 per cent of the patients who are cor- rectly treated and cured, develop a skin condition called Post-Kala- Azar Dermal Leishmaniasis (PKDL) which surfaces within months to years after treatment. These patients can contain large amounts of par- asites in their skin lesions, making them an important source of trans- mission, Dr Harsh Vardhan, Union Health Minister recently pointed out at a meeting held to review the status of the disease. FQSSY^UV_b;QQ1jQbdUcdUTQd28E ?=BQ =4F34;78 Prime Minister Narendra Modi on Friday said the country’s students should work towards building a self-reliant India. He said that by the time India celebrates its 100th Independence day, the nation would also be celebrating the efforts of the students who would be graduating now. “The universities of future will be entirely virtual and stu- dents from any part of the world would be able to study anywhere at anytime,” Modi addressing students and fac- ulty at the 18th convocation of Tezpur University in Assam. “We need to have a regu- latory framework for such transformation and we are continuously trying to achieve that goal with the New Education Policy. The NEP 2020 aims at a flexible and interdisciplinary education system,” he said. The NEP focuses on data and analytics. It has the power to improve the admission, teaching, and evaluation system,” he added in the virtual address. Referring to the incuba- tion centre of the university and innovative technologies emerging out of it, Modi told students that they have great opportunities ahead of them. “Your efforts tell that you have potential,” said the Prime Minister. He also applauded the efforts of varsity in the documentation of tribal lan- guages and culture, waste energy among others. “During the freedom struggle, many brave hearts from Assam have given their lives now you have to live for the AtmaNirbhar Bharat (self- reliant India),” Modi told graduating students asking them to spread the tej (light) of Tezpur University across the nation and the world. In this pandemic circum- stances, the AtmaNirbhar Bharat programme has become a nomenclature in our dictionary but we need to understand what is this change brought by the initia- tive, said Modi. The biggest change is of perspective – the attitude of the entire nation has changed, said Modi. Union Education Minister Ramesh Pokhriyal ‘Nishank’, Assam Chief Minister Sarbananda Sonowal, and Tezpur Lok Sabha MP Pallab Lochan Das also attended the convocation. Citing the Indian cricket team’s recent win against Australia, the Prime Minister said the youth needs to take inspiration from them. “The young team was inexperi- enced and injured, but that didn’t deter their determina- tion and beat one of the best teams in the world,” he men- tioned. A total of 1,218 stu- dents received their degrees and diplomas in the convoca- tion. `UZRUUcVddVd )eYT`_g`TReZ`_ `WEVkafcgRcdZej 6WXGHQWVVKRXOGZRUN WRZDUGVPDNLQJ,QGLD VHOIUHOLDQWH[KRUWV30 ?=BQ =4F34;78 The outbreak of avian influenza, also known as bird flu, has been confirmed in poultry birds in as many as nine States across the country, and in crows, migratory/wild birds in a dozen-odd 12 states, the Union Ministry of Animal Husbandry informed on Friday. In Rajasthan, bird flu has been confirmed in 17 districts of Rajasthan. As many as 6,290 birds have been found dead in the state between December 25, 2020, and January 22, 2021, the state Animal Husbandry Department informed. In Punjab, 11,200 birds were culled at the Alfa Poultry Farm in village Bhera in Derabassi, Aashika Jain Additional Deputy Commissioner told a news agency. About a hundred men were engaged in the operation who worked for around eight hours to conduct the exercise. The team began the job with sedation of birds, fol- lowed by culling via cervical dislocation. Thereafter the birds were buried in deep pits and covered with lime. 1XaSU[dX] !BcPcTb)2T]caT ?=BQ =4F34;78 The 9-feet statue of Govind Ballabh Pant inside Parliament premises has been temporarily relocated and the statue of Motilal Nehru will be moved in the next two-three days to make way for the con- struction of the new building. Meanwhile, the Central Public Works Department has put the central vista redevelop- ment design in public domain and has sought views and objections till January 31. Earlier this week, the Central Public Works Department had shifted the 16-feet bronze statue of Mahatma Gandhi to a spot between Gate 2 and 3 of the Parliament. The construction work of the new Parliament building started on January 15 after the Heritage Conservation Committee gave its approval to the ambitious project under the Central Vista redevelopment plan. “The statue of Pandit Govind Ballabh Pant has been temporarily relocated by the CPWD. The statue of Motilal Nehru, which is also coming in the way of construction of the new building, will also be moved in the next two-three days,” official sources said. They said the statues being moved temporarily will be shifted to a prominent location once the construction com- pletes. There is also a statue of B R Ambedkar which will be moved temporarily, they said. The new parliament build- ing will have a triangular shape and is expected to be com- pleted by the 75th anniversary of India’s independence in 2022. The Government plans to hold the monsoon session of Parliament in 2022 in the new building. Prime Minister Narendra Modi had laid the foundation stone for the new building, being constructed by Tata Projects Ltd, on December 10 last year. The project is estimated to cost Rs 971 crore. Besides the new Parliament building, the rede- velopment of the Central Vista — the nation’s power corridor —envisages a common central secretariat, revamping of the 3- km Rajpath from Rashtrapati Bhavan to India Gate, new prime minister’s residence and prime minister’s office, and a new Vice-President Enclave. BcPcdT^U6^eX]S1P[[PQW ?P]cX]bXST?Pa[XPT]c _aTXbTbaT[^RPcTS ?C8Q =4F34;78 Actor Sonu Sood moved the Supreme Court Friday challenging the Bombay High Court order which dismissed his appeal against a BMC notice over alleged illegal con- struction at his residential building in Mumbai’s Juhu area. Advocate Vineet Dhanda, who has filed the plea in the top court, told PTI that Sood has challenged the high court order. As per the BMC, the Bollywood actor had carried out structural changes in the six-storey residential building ‘’Shakti Sagar’’, and converted it into a hotel without taking requisite permissions. The BMC earlier this month also filed a complaint at the Juhu police station, seeking an FIR to be lodged against Sood for allegedly converting the residential building into a hotel without permission. The complaint letter was sent to the police after the BMC inspected the building and found that Sood had allegedly not complied with the requisitions and was continu- ing unauthorised construction even after the notice was served to him in October last year. The police is yet to regis- ter FIR in the case. B^]dB^^S^eTbB2 PVPX]bc72^aSTa^] X[[TVP[R^]bcadRcX^] ?C8Q =4F34;78 The Supreme Court on Friday refused to accord early hearing to the plea relat- ed to mining major Vedanta’’s Sterlite copper unit at Tuticorin in Tamil Nadu which is closed since May 2018 over pollution concerns. The top court, on December 2, last year had rejected the interim plea of Vedanta Ltd that it be permit- ted to inspect its Sterlite cop- per plant and to operate it for a month to assess the pollution level. Vedanta had sought hand- ing over of the plant for three months saying it requires two months to start the unit and the company should be allowed to run it for four weeks to ascer- tain whether its polluting or not. B2aTUdbTbTPa[hWTPaX]V c^ETSP]cP´bBcTa[XcT R^__Tad]Xc_[TP C746E4A=4=C ?;0=BC7;3 C74=B= B4BB8=5 ?0A;804=C8= !!!8=C74=4F 1D8;38=6
  • 6. ]PcX^]$ 347A03D=kB0CDA30H k90=D0AH !!! Agra: About 21 prisoners from Jammu and Kashmir, presently lodged in various jails of Uttar Pradesh, have been shifted to the high security Agra jail. This is being done on the orders of the Union Home Ministry (MHA). The prisoners being shifted now are believed to be “pro-Pakistan” separatists, of which 10 are associated with Hurriyat leader Syed Ali Shah Geelani. These inmates were booked under Public Safety Act (PSA) and were arrested in the wake of the revocation of special status to the erstwhile state of Jammu and Kashmir under Article 370 of the Constitution in August 2019. According to Senior Superintendent of Agra cen- tral jail, V.K. Singh, “While eight prisoners were already lodged in Agra Central Jail, 17 more have been shifted from Naini, Bareilly and Ambedkar Nagar jails. Four more are scheduled to be transferred from Varanasi Central Jail. All of them will be kept in a high- security cell, away from the other prisoners.” The entire cell is soundproof and under constant CCTV surveillance. Sources said that the jail staff on duty at the special cell have been strictly directed not to speak to any prisoner. Only senior officials would communicate with them, if needed. They would be taken out of the lock-up one by one at a fixed time every day and allowed to walk for a few minutes. Visitors and staffers would be thoroughly checked at the main gate. The entire premises is being monitored by police and provincial armed constabulary (PAC) round-the-clock. In 2019, over 200 prisoners booked under the PSA were transferred to the Agra Central Jail. A year later, most of them were 'temporarily' released on the direc- tives of the MHA.The high-security cell at Agra cen- tral jail was constructed 23 years ago and has a capac- ity to lodge 30 prisoners. IANS 9:_aXb^]Tab bWXUcTSc^0VaPYPX[ Mathura: An organisation here hasdemandedtheinstallationof a statue of demon king Ravan at the Ram temple in Ayodhya. In a letter to Prime Minister Narendra Modi, the Lankesh Bhakta Mandal made the demand. “The Lankesh Bhakta Mandal will bear the cost incurred on the installation of the statue,” Omveer Saraswat, president of the outfit said on Friday. A similar letter has also beendispatchedtothepresident of the Ramjanmabhoomi Nyas, he said. PTI Coimbatore: Panic gripped residents of Madukkarai, near here, when they saw a leopard attacking a dog in the early hours of Friday, police said. The visuals of the attack and ear- lier incidents have gone viral in the social media. At least 20 goats and five dogs were killed by the big cat in the last one year, though the forest department person- nel denied the presence of any leopard in the area, the police said. Adding to the fear of straying wild elephants, the movement of the leopard has made the residents anxious. The incident, wherein the leopard was seen attacking a dog at 1 AM on Friday near the house of a government transport driver, made them even more scary, they said. The residents managed to scare the leopard away while the dog with deep injury in the neck is battling for life, they said. The leopard then entered a near- by house and killed three out of 17 goats, they said. The residents fear the leopard may kill them too, as the human habitats are on the foothill with the easy access to wildlife, they added. Meanwhile, for- est officials visited the spot and noticed the pugmarks of the leopard. They placed a cage to trap it and cameras to monitor its movement. PTI ?P]XRVaX_b aTbXST]cbPb [T^_PaS^]_a^f[ PccPRZbS^V Bengaluru: Karnataka Chief Minister B S Yediyurappa on Friday said five people were killed in the powerful explosion of a truckload of gelatin sticks at a stone crushing unit in Shivamogga district and assured action against unlaw- ful mining and those respon- sible for the mishap. Conceding illegal mining in Shivamogga, his native dis- trict, Yediyurappa said the quarry owner and two of his associates have been arrested for the explosion that occurred on Thursday night and he would inspect the blast site on Saturday. While police last night said at least six labourers in the truck were killed in the explosion that left the bodies dismembered beyond recogni- tion, Yediyurappa told reporters that five people were dead. Announcing an ex-gratia of Rs five lakh each to the fam- ilies of the victims, he said a probe into the explosion was on and a team of officials, includ- ing those from bomb disposal, mines and geology depart- ments, were on the job. A clear picture on the casualty was expected to emerge soon with the authorities not ruling out the possibility of the death toll increasing, citing reports that there may have been more people at the site when the mishap occurred. In a tweet, the Chief Minister said: “My deepest condolences to the bereaved family members. I wish a speedy recovery to the injured.” He told reporters here that he would direct the deputy commissioner of Shivamogga district to release a solatium of Rs five lakh to the families of the victims. “Tomorrow I am going there. There are illegal mining activities going on. I will try to take steps to prevent the repetition of such incidents in future,” he said. Yediyurappa assured appropriate action against those responsible for the explo- sion, the cause of which was under investigation. To a ques- tion on allegations of increase in illegal mining, he said such activities have been stopped at four to five places and stringent action would be initiated to end the menace altogether. The chief minister said the newly inducted Mines and Geology Minister Murugesh Nirani would soon inspect the area. Yediyurappa''s son and Shivamogga MP B Y Raghavendra has already visit- ed the spot. The booming sound of the blast initially made local peo- ple mistake it for an earthquake and it was heard in nearby areas in neighbouring Davangere, Chikkamagaluru and Uttara Kannada districts too. PTI AeQbbi_g^Ub_dXUbcQbbUcdUT+ 3=Q^^_e^SUcC%Q[Xc_QdYe] :0A=0C0:04G?;B8= Chitrakoot (UP): A 15-year- old girl was hacked to death with an axe allegedly after being raped and her four-year- old nephew killed in a village here, police said on Friday. A 30-year-old man from the girl's village has been arrest- ed in connection with the crime which took place on Thursday, they said. “The body of the girl was found in a village on Thursday. She was hacked to death with an axe,” Superintendent of Police Ankit Mittal said. Her nephew was also attacked. He was rushed to the hospital where he died during treatment, he said. Circle Officer Subodh Gautam said the girl was attacked when she was return- ing home after giving food to her father in the field. “Accused Chilua has been arrested by the police. The motive behind the crime is being probed,” the officer said. Gautam said the teenager's family has alleged that she was raped before being murdered. It will be confirmed after the post-mortem examination. “The post-mortem report is awaited,” he said. PTI ?8=44A=4FBB4AE824Q 90D The Administrative Council (AC), which met here under the chairmanship of Lieutenant Governor, Manoj Sinha on Friday approved the adoption of Jammu Kashmir Industrial Land Allotment Policy, 2021-30 to evolve a highly structured industrial land bank for promoting equitable industrial growth in Jammu and Kashmir. The new policy attempts to address var- ious land-related issues impeding industri- al development in JK by laying down a framework to regulate zoning of industrial areas, project appraisal and evaluation, and the subsequent process flow. According to the official spokesperson, “Under the policy, land will be allotted to the investors on lease for an initial period of 40 years, extendable to 99 years. The allotted land will be liable to be can- celled in case of failure of the investor to take effective steps within the stipulated time of 2 years, failure of the industrial unit to come into production within 3 years, violation of provisions under the lease deed, and non- cooperation of an enterprise for a period of 5 years”. Further, the policy also provides renting out of 60% of the built-up area of a business enterprise for setting up an ancillary indus- trial enterprise through a tripartite agree- ment. The spokesperson said, “the policy aims at achieving inclusive growth through sus- tainable industrialization and employment generation, and includes provisions for evolving a fair and transparent mechanism for land allotment for industrial use”. “The new policy proposes zoning of industrial areas at block/ municipality level after taking into consideration various fac- tors including the existing level of industri- al development, location of the proposed zone, and level of urbanization. The Jammu and Kashmir Industrial Land Allotment Policy, 2021-30 will also cover land allotment for health institutions/medi-cities and edu- cational institutions/edu-cities”, official spokesperson added. The policy provides for constitution of Divisional Level Project Appraisal and Evaluation Committees to scrutinize appli- cations received for allotment of industrial land within 30 days; Apex Level Land Allotment Committee, High Level Land Allotment Committee and Divisional Level Land Allotment Committee to decide and allot industrial land to the applicant within 45 days in cases of projects worth Rs. 200 crore, Rs. 50-200 crore and up to Rs. 50 crore, respectively. - .,QGXVWULDOODQGDOORWPHQW SROLFDSSURYHG Kolkata: The Election Commission of India on Friday asked the Bengal political parties to exercise restraint while choos- ing their words particularly for armed forces. While it termed the allega- tions made by Trinamool Congress against the Border Security Forces without producing evidence as “unfortunate” and avoidable, it also called the BJP’ contentions that the names of 4- 5 lakh Rohingyas had been ille- gally included in the electoral rolls as unsubstantiated. Describing allegations made by a political party against the BSF as “unfortunate,” Chief Election Commissioner Sunil Arora said that it was “one of the finest forces in the country,” adding the political party concerned should come up with facts to support its allegations. Earlier the Trinamool Congress alleged that the BSF was threatening people living (within 15 km) of the international bor- der to make them cast their votes in favour of a particular political party. On BJP’s allegations that the names of 4-5 lakh Rohingyas had been incorporated in the electoral rolls he said such allegations were baseless adding the full bench of the EC which was currently trav- eling Bengal had asked the State Chief Secretary and Home Secretary to look into the issues of fake information in the social media raised by political parties. Talking tough on the bureau- crats particularly the police top brass the CEC said that poll panel had “zero-tolerance” insofar as “money and muscle power and misuse of the government machin- ery”wasconcerned.Healsosaidno civic police volunteers will be deployed during the elections. Sources said that the ECI was mulling “transfer, suspensions and even charge-sheets” against officials acting with bias. “The Commission may blacklist offi- cials and even suspend, transfer or charge-sheet them,” sources said, adding, “like on earlier occasions any complaint, instead of being responded with show cause notices will be followed up with prompt removal.” PNS Raipur:Breaking the paddy procurement record of last 20 years, Chhattisgarh State has recorded highest quantity of paddy procurement this year. In the ongo- ing procurement sea- son this year, nearly 84 lakh 44 thousand metric tons of paddy has been procured till January 21, which is 50 thousand met- ric tons more than the quanti- ty of paddy procured last year. It is noteworthy that nearly 83.94 lakh metric tons of paddy was procured in the season of last year. Under the leadership of Chief Minister Mr. Bhupesh Baghel, the quantity of paddy procurement as well as the number of farmers and agri- culture yield has consistently increased in last two years. As a result of State Government’s pro-farmer policy, Chhattisgarh is emerging as a model state for the country in the agri- culture sector. C h h a t t i s g a r h Government’s Rajiv Gandhi Kisaan Nyay Yojana has boosted the crop production in the state. In the current fiscal year, State Government has distributed the incentive amount of Rs 5750 crore to 19 lakh farmers of the state under Rajiv Gandhi Kisaan Nyay Yojana. Till date, 19 lakh 54 thousand 332 farmers have sold paddy at support price till date. DO of 27 lakh 70 thousand 693 metric tons of paddy has been issued to the millers for custom milling, against which nearly 25 lakh 45 thousand 512 metric tons of paddy has been transported already. Amaravati (AP): At least 22 people Fell ill in Eluru city and anearbymandalheadquartersin West Godavari district of Andhra Pradesh on Friday but Deputy Chief Minister (Health) A K K Srinivas suspected there could be a “conspiracy” behind it. This comes more than a month after several hundred people in Eluru fell ill with symptoms of nausea in the first week of December last year. The Deputy Chief Minister, who visited Poolla in West Godavari district and enquired about the situation from the vic- tims'families,saidtheycouldnot rule out a conspiracy behind the outbreak of the mysterious ill- ness. “We are thinking if there is a conspiracy.We have this sus- picion, going by what the peo- ple here said.So, we can't rule that out.But we can't confirm that as well,” Srinivas told a Telugu television news channel. Official sources said the 22 persons suddenly fell uncon- scious as froth oozed from their mouths and they complained of giddiness. “Six of these patients have been discharged after treatment while 15 were admitted to the District Hospital in Eluru.Another person was get- ting treated in the local hospi- tal in Poolla mandal headquar- ters,” a senior official said. “We have collected water and food samples from the houses of the victims and also nearby hotels and the wholesale vegetable market at Gundugolanu.We are collecting samples of meat, chicken, milk, riceandfertilisersusedinpaddy cultivation,” he added. ChiefSecretaryAdityaNath Das, Principal Secretary (Health) Anil Kumar Singhal, Health Commissioner Katamaneni Bhaskar rushed to Eluru to take stock of the situ- ation. PTI C2aTPaZ^]1B5 d]U^acd]PcTbPhb42 C=A067D=0C70Q D108 Aday after a massive fire claimed five lives and gut- ted its equipment and products at the proposed BCG and Rotavirus vaccine manufac- turing facility, Serum Institute of India (SII) on Friday pegged the losses suffered by it at Rs 1,000 crore, even as Maharashtra chief minister Uddhav Thackeray visited the fire ravaged SII premises. Addressing a joint news conference with the chief min- ister, SII’s Chief Executive Officer (CEO) Adar Poonawala said that there was no damage to the place where Covishield was manufactured and stored. “The mishap took place at a brand new facility. It was for the future production of BCG and Rotavirus,” he said. “Equipment and products worth Rs 1,000 crore were damaged in the fire... The loss is mainly financial. There is no loss to supplies as such,” Poonawalla said. Poonawala said that at the place where the fire broke out, “no actual vaccine was actual- ly being produced there, so there was no damage to any vaccine”. While the fire swept through the third and fourth floors of the upcoming facility in Manjari that was scheduled to become operational within a month, the Covishield Vaccine that is currently being manufactured at its other plant which is one km away. The chief minister, accom- panied by Tourism Minister Aditya Thackeray, Deputy Chairperson of Maharashtra Legislative Council Neelam Gorhe, Pune MP Girish Bapat, visited the SII facility and met the company Chairman Cyrus Poonawalla and his son Adar. Declining to comment on the progress of investigations into the circumstances leading to Thursday’s fire, Uddhav said: “We have ordered a thor- ough probe. There cannot be any conclusions till the full investigations are complete and the report is available. It is then we will know whether it was an accident or sabotage” the chief minister said. The chief minister said that Poonawallas had repeat- edly assured him that there would be no impact on the Covishield Vaccine produc- tion, stocks and rollout which would continue unhindered. After the chief minister’s visit to the mishap-hit SII facil- ity, Adar Poonwala tweeted: “Thank you Shri Uddhav Ji @CMOMaharashtraand @AUThackerayfor visiting @SerumInstIndiaand extend- ing your help and support dur- ing this terrible crisis. As you have seen, the production of #COVISHIELD is on schedule and remains unaffected by this tragedy. Meanwhile, the SII has announced a compensation of Rs 25 lakh to the next of kin of each of the five labourers, including 3 migrants, killed in the blaze. On his part, the chief min- ister said that if any more assistance was needed to be extended to the bereaved fam- ilies, the state government would consider it. In a related development, Pune’s Hadapsar Police have registered an accidental death, the Pune Municipal Corporation, Pune Metropolitan Region Development Authority and Maharashtra Industrial Development Corporation have launched simultaneous investigations into the fire. It may be recalled that five persons were killed and others evacuated safely after a massive fire broke out in an under-con- struction building at the Covid- 19 vaccine manufacturer Serum Institute of India (SII) in Pune on Thursday afternoon. The fire, which broke out at around 2.30 pm, swept through the fourth and fifth floors of an under-construction building at Manjari, which is one kilometer away from the SII facility where Covid vac- cines are being manufactured. Manjari is a complex in Special Economic Zone where SII’s half a dozen buildings are being constructed. The fire was brought under control within three hours. The five deceased labour- ers were identified as Rama Shankar Harijan and Bipin Saroj, both from Uttar Pradesh, Sushil Kumar Pandey, who hails from Bihar and Mahendra Ingle and Pratik Pashte, both residents of Pune. All of them were contractual labourers. They were carrying out some electrical work at the site, when the mishap occurred. C=A067D=0C70Q D108 As part of its ongoing inves- tigations into the Punjab Maharashtra Cooperative (PMC) Bank Ltd. scam, the Enforcement Directorate (ED) on Friday raided five premises belonging to the Viva Group and its associates in Mumbai and Palghar and seized a cash of Rs 73 lakh. Following upon the leads got it by that a large amount of money had allegedly been transferred from HDIL to Mehul Thakur-controlled com- panies and trusts the ED raid- ed Viva Group’s offices at Andheri and Virar in Palghar district, residences of its top officials at Andheri, Juhu and Chembur in Mumbai. In the raids conducted on three premises linked to the Viva Groups’ head and two others connected with char- tered accountants/financial consultants, the ED seized Rs 73 lakh in cash and incrimi- nating documents. It may be recalled that after the PMC bank scam broke out in September 2019, the Economic Offences Wing (EOW) of Mumbai Police had arrested two promoters of the Housing Development and Infrastructure Limited (HDIL) Sarang Kumar Wadhawan and Rakesh Wadhawan in connec- tion with 5366 crore PMC Bank scam. Subsequently, the ED launched a probe against HDIL’s promoters Rakesh Wadhawan and Sarang Wadhawan, PMC Bank’s for- mer Chairman Waryam Singh and MD Joy Thomas, in con- nection with the same scam. The ED seized several properties of Rakesh Wadhawan and Wadhawan Family Trust worth Rs.293 crore, while it also seized jew- ellery worth Rs.63 crore were seized and attached and launched proceedings against them under the Prevention of Money-laundering Act (PMLA). The investigations had revealed that the Wadhawans and Viva Group connived to divert over Rs.160-crore from HDIL to many companies of the latter (Viva Group) dis- guised as ‘commission’, though the funds were apparently an illegal diversion from the PMC Bank. Simultaneously, the ED started probing another case against Rakesh Wadhawan and Sarang Wadhawan for siphon- ing off a long of Rs.200 crore sanctioned by Yes Bank to the Mack Star Marketing Pvt. Ltd., by allegedly showing some fic- titious purposes. XPWP2CWPRZTaPheXbXcb_aTXbTb XB88´b24bPhb]^SPPVTRPdbTSc^ePRRX]T 30 EDQNVFDP('UDLGV9LYDJURXS DVVRFLDWHV¶SUHPLVHVVHL]HVC/FDVK B0D60AB4=6D?C0Q :;:0C0 Amid speculation that more politicians might join the BJP ranks during Home Minister Amit Shah's January 31 rally in Howrah, another Bengal Minister Rajib Banerjee on Friday put in his papers holding out some emotional details before the media moments after tendering his resignation to Governor Jagdeep Dhankhar. An hour later, Chief Minister Mamata Banerjee reportedly removed the Forest Minister from his posi- tion because there were some procedural lapses on his part in tendering his resignation. Sources at State Secretariat Nabanna said that he was being removed as he had tendered his resignation to the Governor instead of the Chief Minister who was his official appointee as the leader of the Cabinet. While the Trinamool Congress leadership promptly responded to the latest resig- nation drama saying a bucket of water taken out of the ocean would not matter much, besides raising some feeble corruption charges against the just former Minister who was yet to quit the party, Rajib said he had made up his mind to resign more than two years ago after the Chief Minister removed him unceremonious- ly as the Irrigation Minister. Most regretfully I inform you that I have tendered my resignation from my office as Cabinet Minister being in charge of Forest Department, an emotional Rajib Banerjee said adding he had never thought that such a situation will come someday … but I had taken a decision more than two years ago when the Chief Minister removed me from the Irrigation Department without any prior intimation … I had to know it from the tele- vision breaking news even as I was busy meeting my party men in North Bengal. It was a hurtful situation as the Chief Minister should at least have informed me before taking such decision … it should be the minimum cour- tesy … there is no problem in changing portfolios by the Chief Minister who is the mas- ter of the situation … but there is a way to do things … and why I still continued as the Forest Minister is because when I told her that I was quit- ting from all Government posts she persuaded me to continue and I could not disregard her requests at that point in time. Rajib is still an MLA, a party member said that he would continue to work for the people in future, dropping suggestions that he was in look out for some platform. He said, I do not know which platform I will get and from where I will work for the people but I will continue to work for them till I am alive. Moments after Bengal BJP president Dilip Ghosh offered him a platform saying though he still continues to be a TMC leader we have not problem accepting him in our party should he decide to join us. Rajib is the third Minister to resign from the Government in a month after Suvendu Adhikari and Laxmi Ratan Shukla. Rajib had been critical of the Government and the party telling openly in the public how corrupt sidekicks of top lead- ership always got the plum positions and the dedicated ones were ignored. In a Facebook Live post he rued the falling economic condition of Bengal where the youth were forced to leave the State in lakhs in search of jobs. Reacting to the Friday's development Bengal Minister and TMC general secretary Partho Chatterjee said a buck- et of water taken out of the ocean does not dry it up and the TMC is that ocean, while Trinamool MP Kalyan Banerjee made suggestive state- ments saying the Forest Minister was aggrieved because he was removed from the Irrigation Department where he had the opportunity to work with a large number of con- tractors. $QRWKHU%HQJDO0LQ TXLWVPDMRLQ%-3 7XVWTbc`dP]cXch^U_PSSh _a^RdaTScWXbhTPaX]2WWPccXbVPaW jVRc`]UXZc]_VaYVhZ]]VUZ_ FAd4YZecR``e,cRaVdfdaVTeVU SHRSOHIDOOLOOLQ(OXUX$3 'HSXW0VXVSHFWVFRQVSLUDF Dhaka: Bangladesh Prime Minister Sheikh Hasina has thanked her Indian counter- part Narendra Modi for send- ing over two million doses of Covid-19 vaccine as a gift to Bangladesh. India on Thursday offi- cially handed over 2 million doses of domestically pro- duced Covishield vaccine to Bangladesh. The vaccines were provided at a crucial time when the number of coron- avirus cases in Bangladesh is rising. “I thank Prime Minister Narendra Modi for sending the vaccine (batch) as a gift,” Hasina said at an online inter- national conference held on the occasion of the 100th founding anniversary of the University of Dhaka on Thursday. She said the government has already planned how it would proceed with the vac- cine, the Dhaka Tribune reported. “We have taken all the steps to face the COVID-19 sit- uation in the country,” Hasina said. Apart from the current delivery of vaccines, Bangladesh is also set to pur- chase 3 crore doses of India- made coronavirus vaccine. Hasina hoped that the vac- cine that Bangladesh procured from India would arrive by January 25-26, the report said. Bangladesh has so far recorded 7,966 COVID-19 deaths since the outbreak of the pandemic in March last year, while the total number of infections have surged to over 530,270. PTI % GHVK30+DVLQDWKDQNV 0RGLIRURYLGYDFFLQHJLIW PcWdaP^dcUXcbTTZbAPeP] bcPcdTPc0h^SWhPcT_[T D::A68D7:C6=@DD2EC!!!4C