SlideShare ist ein Scribd-Unternehmen logo
1 von 36
Downloaden Sie, um offline zu lesen
© 2018, Amazon Web Services, Inc. or its affiliates. All rights reserved.
AI Summit
Intelligent Systems for Cancer Genomics
Mona Singh, Princeton University
Cancer in the United States
1 in 3 lifetime
risk of developing
cancer
1 in 5 lifetime
risk of dying from
cancer
Source: American Cancer Society
Cancer Cells Acquire Mutations
+
tumor cellsnormal cells
tumor biopsy
Individual’s (normal)
blood sample
mutations in cells
Healthy cells: ATTCGTCATGCGTGACGAGATCGAGCTAGCGCGAAATCGAGCGATC...
Cancer cells: ATTCGTCATGCGTGACGAGATCGAGCTAGCGCGAAATCGAGCGATC...
Personalized Cancer Treatments
Cancer Genome Landscapes
32 cancer subtypes
11,315 patient samples
• 22 cancer subtypes
• 20,487 patient samples
• Many mutations per cancer genome
• Only a few mutations within an individual “drive” the cancer
Mutationsper1MillionDNAbases
Cancer Genome Landscapes
32 cancer subtypes
11,315 patient samples
• 22 cancer subtypes
• 20,487 patient samples
• Many mutations per cancer genome
• Only a few mutations within an individual “drive” the cancer
Mutationsper1MillionDNAbases
❶ Discover “causal” cancer
driver mutations and genes
❷ Predict drug response
© 2018, Amazon Web Services, Inc. or its affiliates. All rights reserved.
Uncovering Cancer Genes In The Context of Other
Information
AAATCGAGGCGATC...
ATATCGAGTCGATC...
ATATCGAGTCGATC...
CAATCGAGGCGATC...
ATATCGAGGCGGTC...
TTATCGAGGAGATC...
8,608,691 varying sites
60,706 individuals
WWbZIP
Bromo
ZF ZF ZF
Population Genomic Data Probabilistic Sequence
Patterns
16,230 “domains” cover 88%
of human proteins
Protein Structures
>127,000 PDB structures
Biological Networks
~300,000 interactions
Proteins Function Through Interactions
protein 1 protein 2 protein 3 protein 20K
protein−RNA
protein−ionprotein−DNAprotein−protein
protein−small molecule
MISILRRGLLVLLAAFPLLALAVQTPHEVVQS
TTNELLGDLKANKEQYKSNPNAFYDSLNRILG
PVVDADGISRSIMTVKYSRKATPEQMQRFQEN
FKRSLMQFYGNALLEYNNQGITVDPAKADDGK
RASVGMKVTGNNGAVYPVQYTLENIGGEWKVR
NVIVNGINIGKLFRDQFADAMQRNGNDLDKTI
DGWAGEVAKAKQAADNSPEKSVKLEHHHHHH
Proteins function &
interact in 3D
Proteins 1D representation
“read” of the genome
Specific Mutations Alter Function
MISILRRGLLVLLAAFPLLALAVQTPHEVVQS
TTNELLGDLKANKEQYKSNPNAFYDSLNRILG
PVVDADGISRSIMTVKYSRKATPEQMQRFQEN
FKRSLMQFYGNALLEYNNQGITVDPAKADDGK
RASVGMKVTGNNGAVYPVQYTLENIGGEWKVR
NVIVNGINIGKLFRDQFADAMQRNGNDLDKTI
DGWAGEVAKAKQAADNSPEKSVKLEHHHHHH
MISILRRGLLVLLAAFPLLALAVQTPHEVVQS
TTNELLGDLKANKEQYKSNPNAFYDSLNRILG
PVVDADGISRSIMTVKYSRKATPEQMQRFQEN
FKRSLMQFYGNALLEYNNQGITVDPAKADDGK
RASVGMKVTGNNGAVYPVQYTLENIGGEWKVR
NVIVNGINIGKLFRDQFADAMQRNGNDLDKTI
DGWAGEVAKAKQAADNSPEKSVKLEHHHHHH
Proteins function &
interact in 3D
Proteins 1D representation
“read” of the genome
Specific Mutations Alter Function
MISILRRGLLVLLAAFPLLALAVQTPHEVVQS
TTNELLGDLKANKEQYKSNPNAFYDSLNRILG
PVVDADGISRSIMTVKYSRKATPEQMQRFQEN
FKRSLMQFYGNALLEYNNQGITVDPAKADDGK
RASVGMKVTGNNGAVYPVQYTLENIGGEWKVR
NVIVNGINIGKLFRDQFADAMQRNGNDLDKTI
DGWAGEVAKAKQAADNSPEKSVKLEHHHHHH
Hypothesis:
Cancer cells malfunction due to
mutations that change
interactions & networks
MISILRRGLLVLLAAFPLLALAVQTPHEVVQS
TTNELLGDLKANKEQYKSNPNAFYDSLNRILG
PVVDADGISRSIMTVKYSRKATPEQMQRFQEN
FKRSLMQFYGNALLEYNNQGITVDPAKADDGK
RASVGMKVTGNNGAVYPVQYTLENIGGEWKVR
NVIVNGINIGKLFRDQFADAMQRNGNDLDKTI
DGWAGEVAKAKQAADNSPEKSVKLEHHHHHH
Proteins function &
interact in 3D
Proteins 1D representation
“read” of the genome
Specific Mutations Alter Function
MISILRRGLLVLLAAFPLLALAVQTPHEVVQS
TTNELLGDLKANKEQYKSNPNAFYDSLNRILG
PVVDADGISRSIMTVKYSRKATPEQMQRFQEN
FKRSLMQFYGNALLEYNNQGITVDPAKADDGK
RASVGMKVTGNNGAVYPVQYTLENIGGEWKVR
NVIVNGINIGKLFRDQFADAMQRNGNDLDKTI
DGWAGEVAKAKQAADNSPEKSVKLEHHHHHH
Goal:
ID cancer genes by identifying
those with an enriched number
of mutations in interaction sites
across tumor samples
22,712total genes in human
61%13,923Computationally inferred interaction site info
2,871 13% genes w/ structural knowledge of any interaction sites
0
1
MISILRRGLLVLLAAFPLLALAVQTPHEVVQSTTNELLGDLKANKE
Partial, per-position 0 to 1
interaction potential
Uncovering Significantly Mutated Binding Sites
N C
no known interactionsmodeled interactions
0
1
1 20 3
Somatic mutations
per-position binding
potentials
Xi
sum of binding potentials where
mutations land
analytically compute mean
and variance
Z-score:
Xi
~7X speedup per shuffle
Typically >1,000 shuffles
Uncovering Significantly Mutated Interaction Sites
How to consider information together?
standardized
multivariate Gaussian
0
+1
-1
-1
0
+1
PertInInt: Integrative Approach to Uncover Cancer Genes
analytically compute
covariance matrix
PertInInt Identifies Cancer-Relevant Genes
Frequency based
Conservation
Domain
Interaction
All
Gene Rank
EnrichmentofGenesintheCancerGene
Census
30
20
10
0 1 50 100 150 200
~10 minutes
to process 10,000+ tumor samples
(2.4-2.7Ghz processor, <4GB RAM)
PertInInt In Summary
ZF ZF ZF
H. sap. MEGDAVEAIVEES...
P. tro. MENEPSEVILEEN...
G. gor. MEGGPTEAVVEDA...
P. mar. MEKILQMAEGIDI...
*** * **
• Perturbed interactions predictive for cancer genes
• Integrative framework identifies cancer-relevant
genes
– Novel and distinct mutational avenues for driver
genes
• Alternate way to prioritize mutations in an
individual’s cancerAAATCGAGGCGATC...
ATATCGAGTCGATC...
© 2018, Amazon Web Services, Inc. or its affiliates. All rights reserved.
Tumor Growth in the Presence of Drug “X”
Illustration obtained from Verschoor et al. 2013
Compound is more effective
Compound is less effective
Drug Effectiveness Varies Across Tumor Cells
Source: Genomics of Drug Sensitivity in Cancer (GDSC)
Activity of 250 compounds on 960 cell lines
~160K drug-cell pairings
Cancer Cells Are Heterogeneous
cells
~20Kgenes
Our Data
Activity of drugs on diverse cell lines
Gene expression measurements on
untreated cells
Chemical structure of drugs
Goal: Predict activity of drugs on a
tumor using gene expression
profiles
and drug features
New tumors, new drugs!
Genomics Data Has Modular Structure
Illustration obtained from https://rgd.mcw.edu/rgdweb/pathway/pathwayRecord.html?acc_id=PW:0000
Can we use this modular information
to aid in our predictions?
Solution
Use modular knowledge of cellular function
Starting feature space: 960 cell lines x 20K features
(Resistant/Sensitive)
Approach: Autoencoders
Neural network approach to obtain a reduced feature space using
a guided modular genomics approach.
Use gene set autoencoded features for prediction
Merging Multiple Genomic Sources
Mutation within known cancer genes (CGCs)
Reduced set of gene expression values
The Other Half: Structure of Drugs
Features: 2D structural descriptors (chemical
subgroups) and physical features (e.g., size, charge)
Starting space: 250 drug compounds
Chemical Features
881 substructure descriptions as a vector of binary features
Physical Features
1444 PaDEL physicochemical features from SMILES strings.
Molecular free energy, volume, topology.
Apply autoencoders to reduce feature space (90 features)
Combine Input to Model
165K Cell-Drug Pairs
Deep Neural Network on Combined Data
Cross-Validation Testing: Leave All Samples Out Per
Drug
Comparison to Previous Leave-One Out Per Drug
Summary
• Biologically-guided deep net approach to
predict response to drugs
• By training model across drugs and tumors,
can make predictions for new drugs & tumors
• Ultimate goals:
–Personalized oncology
–In silico drug development
Thank you!
© 2018, Amazon Web Services, Inc. or its affiliates. All rights reserved.
Mona Singh
mona@cs.princeton.edu
Shilpa Kobren Jose Zamalloa

Weitere ähnliche Inhalte

Was ist angesagt?

Mining Gene Expression Data Focusing Cancer Therapeutics: A Digest
Mining Gene Expression Data Focusing Cancer Therapeutics: A DigestMining Gene Expression Data Focusing Cancer Therapeutics: A Digest
Mining Gene Expression Data Focusing Cancer Therapeutics: A DigestKaashivInfoTech Company
 
Translating Genomes | Personalizing Medicine
Translating Genomes | Personalizing MedicineTranslating Genomes | Personalizing Medicine
Translating Genomes | Personalizing MedicineCandy Smellie
 
From reads to pathways for efficient disease gene finding
From reads to pathways for efficient disease gene findingFrom reads to pathways for efficient disease gene finding
From reads to pathways for efficient disease gene findingJoaquin Dopazo
 
Cancer therapy at protein level
Cancer therapy at protein levelCancer therapy at protein level
Cancer therapy at protein levelSuganyaPaulraj
 
chromosomal abnormalities by Iqra malik
chromosomal abnormalities by Iqra malik chromosomal abnormalities by Iqra malik
chromosomal abnormalities by Iqra malik hafizaiqramalik
 
Array cgh ftnw
Array cgh ftnwArray cgh ftnw
Array cgh ftnw鋒博 蔡
 
Identification of cancer drivers across tumor types
Identification of cancer drivers across tumor typesIdentification of cancer drivers across tumor types
Identification of cancer drivers across tumor typesNuria Lopez-Bigas
 
OncoRep: A n-of-1 reporting tool to support genome-guided treatment for breas...
OncoRep: A n-of-1 reporting tool to support genome-guided treatment for breas...OncoRep: A n-of-1 reporting tool to support genome-guided treatment for breas...
OncoRep: A n-of-1 reporting tool to support genome-guided treatment for breas...Tobias Meißner
 
In Silico Prescription of Anticancer Drugs Reveals Targeting Opportunities
In Silico Prescription of Anticancer Drugs Reveals Targeting OpportunitiesIn Silico Prescription of Anticancer Drugs Reveals Targeting Opportunities
In Silico Prescription of Anticancer Drugs Reveals Targeting OpportunitiesNuria Lopez-Bigas
 
APPLICATION OF NEXT GENERATION SEQUENCING (NGS) IN CANCER TREATMENT
APPLICATION OF  NEXT GENERATION SEQUENCING (NGS)  IN CANCER TREATMENTAPPLICATION OF  NEXT GENERATION SEQUENCING (NGS)  IN CANCER TREATMENT
APPLICATION OF NEXT GENERATION SEQUENCING (NGS) IN CANCER TREATMENTDinie Fariz
 
Proteogenomic analysis of human colon cancer reveals new therapeutic opportun...
Proteogenomic analysis of human colon cancer reveals new therapeutic opportun...Proteogenomic analysis of human colon cancer reveals new therapeutic opportun...
Proteogenomic analysis of human colon cancer reveals new therapeutic opportun...Gul Muneer
 
Assessing the clinical utility of cancer genomic and proteomic data across tu...
Assessing the clinical utility of cancer genomic and proteomic data across tu...Assessing the clinical utility of cancer genomic and proteomic data across tu...
Assessing the clinical utility of cancer genomic and proteomic data across tu...Gul Muneer
 
Multigenic (mechanistic) biomarkers
Multigenic (mechanistic) biomarkersMultigenic (mechanistic) biomarkers
Multigenic (mechanistic) biomarkersJoaquin Dopazo
 
Lopez-Bigas talk at the EBI/EMBL Cancer Genomics Workshop
Lopez-Bigas talk at the EBI/EMBL Cancer Genomics WorkshopLopez-Bigas talk at the EBI/EMBL Cancer Genomics Workshop
Lopez-Bigas talk at the EBI/EMBL Cancer Genomics WorkshopNuria Lopez-Bigas
 
Cellular level cancer therapy
Cellular level  cancer therapyCellular level  cancer therapy
Cellular level cancer therapySuganyaPaulraj
 
Bioinformatics and NGS for advancing in hearing loss research
Bioinformatics and NGS for advancing in hearing loss researchBioinformatics and NGS for advancing in hearing loss research
Bioinformatics and NGS for advancing in hearing loss researchJoaquin Dopazo
 
Sequencing 60,000 Samples: An Innovative Large Cohort Study for Breast Cancer...
Sequencing 60,000 Samples: An Innovative Large Cohort Study for Breast Cancer...Sequencing 60,000 Samples: An Innovative Large Cohort Study for Breast Cancer...
Sequencing 60,000 Samples: An Innovative Large Cohort Study for Breast Cancer...QIAGEN
 

Was ist angesagt? (20)

Mining Gene Expression Data Focusing Cancer Therapeutics: A Digest
Mining Gene Expression Data Focusing Cancer Therapeutics: A DigestMining Gene Expression Data Focusing Cancer Therapeutics: A Digest
Mining Gene Expression Data Focusing Cancer Therapeutics: A Digest
 
Translating Genomes | Personalizing Medicine
Translating Genomes | Personalizing MedicineTranslating Genomes | Personalizing Medicine
Translating Genomes | Personalizing Medicine
 
From reads to pathways for efficient disease gene finding
From reads to pathways for efficient disease gene findingFrom reads to pathways for efficient disease gene finding
From reads to pathways for efficient disease gene finding
 
Cancer therapy at protein level
Cancer therapy at protein levelCancer therapy at protein level
Cancer therapy at protein level
 
chromosomal abnormalities by Iqra malik
chromosomal abnormalities by Iqra malik chromosomal abnormalities by Iqra malik
chromosomal abnormalities by Iqra malik
 
Single cell pcr
Single cell pcrSingle cell pcr
Single cell pcr
 
Array cgh ftnw
Array cgh ftnwArray cgh ftnw
Array cgh ftnw
 
Identification of cancer drivers across tumor types
Identification of cancer drivers across tumor typesIdentification of cancer drivers across tumor types
Identification of cancer drivers across tumor types
 
OncoRep: A n-of-1 reporting tool to support genome-guided treatment for breas...
OncoRep: A n-of-1 reporting tool to support genome-guided treatment for breas...OncoRep: A n-of-1 reporting tool to support genome-guided treatment for breas...
OncoRep: A n-of-1 reporting tool to support genome-guided treatment for breas...
 
In Silico Prescription of Anticancer Drugs Reveals Targeting Opportunities
In Silico Prescription of Anticancer Drugs Reveals Targeting OpportunitiesIn Silico Prescription of Anticancer Drugs Reveals Targeting Opportunities
In Silico Prescription of Anticancer Drugs Reveals Targeting Opportunities
 
APPLICATION OF NEXT GENERATION SEQUENCING (NGS) IN CANCER TREATMENT
APPLICATION OF  NEXT GENERATION SEQUENCING (NGS)  IN CANCER TREATMENTAPPLICATION OF  NEXT GENERATION SEQUENCING (NGS)  IN CANCER TREATMENT
APPLICATION OF NEXT GENERATION SEQUENCING (NGS) IN CANCER TREATMENT
 
Proteogenomic analysis of human colon cancer reveals new therapeutic opportun...
Proteogenomic analysis of human colon cancer reveals new therapeutic opportun...Proteogenomic analysis of human colon cancer reveals new therapeutic opportun...
Proteogenomic analysis of human colon cancer reveals new therapeutic opportun...
 
Assessing the clinical utility of cancer genomic and proteomic data across tu...
Assessing the clinical utility of cancer genomic and proteomic data across tu...Assessing the clinical utility of cancer genomic and proteomic data across tu...
Assessing the clinical utility of cancer genomic and proteomic data across tu...
 
Multigenic (mechanistic) biomarkers
Multigenic (mechanistic) biomarkersMultigenic (mechanistic) biomarkers
Multigenic (mechanistic) biomarkers
 
Lopez-Bigas talk at the EBI/EMBL Cancer Genomics Workshop
Lopez-Bigas talk at the EBI/EMBL Cancer Genomics WorkshopLopez-Bigas talk at the EBI/EMBL Cancer Genomics Workshop
Lopez-Bigas talk at the EBI/EMBL Cancer Genomics Workshop
 
Published-PageOne
Published-PageOnePublished-PageOne
Published-PageOne
 
Cellular level cancer therapy
Cellular level  cancer therapyCellular level  cancer therapy
Cellular level cancer therapy
 
Cancer and CNV
Cancer and CNVCancer and CNV
Cancer and CNV
 
Bioinformatics and NGS for advancing in hearing loss research
Bioinformatics and NGS for advancing in hearing loss researchBioinformatics and NGS for advancing in hearing loss research
Bioinformatics and NGS for advancing in hearing loss research
 
Sequencing 60,000 Samples: An Innovative Large Cohort Study for Breast Cancer...
Sequencing 60,000 Samples: An Innovative Large Cohort Study for Breast Cancer...Sequencing 60,000 Samples: An Innovative Large Cohort Study for Breast Cancer...
Sequencing 60,000 Samples: An Innovative Large Cohort Study for Breast Cancer...
 

Ähnlich wie Intelligent Systems for Cancer Genomics (AIS305) - AWS re:Invent 2018

PICS: Pathway Informed Classification System for cancer analysis using gene e...
PICS: Pathway Informed Classification System for cancer analysis using gene e...PICS: Pathway Informed Classification System for cancer analysis using gene e...
PICS: Pathway Informed Classification System for cancer analysis using gene e...David Craft
 
정밀의료 시대의 딥러닝
정밀의료 시대의 딥러닝정밀의료 시대의 딥러닝
정밀의료 시대의 딥러닝NAVER Engineering
 
Genomics 2015 Keynote - Utilizing cancer sequencing in the clinic
Genomics 2015 Keynote - Utilizing cancer sequencing in the clinicGenomics 2015 Keynote - Utilizing cancer sequencing in the clinic
Genomics 2015 Keynote - Utilizing cancer sequencing in the clinicAndreas Scherer
 
CDAC 2018 Gonzales-Perez interpretation of cancer genomes
CDAC 2018 Gonzales-Perez interpretation of cancer genomesCDAC 2018 Gonzales-Perez interpretation of cancer genomes
CDAC 2018 Gonzales-Perez interpretation of cancer genomesMarco Antoniotti
 
Mastering RNA-Seq (NGS Data Analysis) - A Critical Approach To Transcriptomic...
Mastering RNA-Seq (NGS Data Analysis) - A Critical Approach To Transcriptomic...Mastering RNA-Seq (NGS Data Analysis) - A Critical Approach To Transcriptomic...
Mastering RNA-Seq (NGS Data Analysis) - A Critical Approach To Transcriptomic...Elia Brodsky
 
Cancer recognition from dna microarray gene expression data using averaged on...
Cancer recognition from dna microarray gene expression data using averaged on...Cancer recognition from dna microarray gene expression data using averaged on...
Cancer recognition from dna microarray gene expression data using averaged on...IJCI JOURNAL
 
Visual Exploration of Clinical and Genomic Data for Patient Stratification
Visual Exploration of Clinical and Genomic Data for Patient StratificationVisual Exploration of Clinical and Genomic Data for Patient Stratification
Visual Exploration of Clinical and Genomic Data for Patient StratificationNils Gehlenborg
 
Gene expression profiling reveals molecularly and clinically distinct subtype...
Gene expression profiling reveals molecularly and clinically distinct subtype...Gene expression profiling reveals molecularly and clinically distinct subtype...
Gene expression profiling reveals molecularly and clinically distinct subtype...Yu Liang
 
Applications of Next generation sequencing in Drug Discovery
Applications of Next generation sequencing in Drug DiscoveryApplications of Next generation sequencing in Drug Discovery
Applications of Next generation sequencing in Drug Discoveryvjain38
 
Next generation Sequencing in Drug Discovery
Next generation Sequencing in Drug DiscoveryNext generation Sequencing in Drug Discovery
Next generation Sequencing in Drug DiscoveryVanshikaJain757478
 
Applications of microarray
Applications of microarrayApplications of microarray
Applications of microarrayprateek kumar
 
QMB_Poster_Tom_Kelly
QMB_Poster_Tom_KellyQMB_Poster_Tom_Kelly
QMB_Poster_Tom_KellyTom Kelly
 
[DSC Europe 23][DigiHealth] Tomislav Krizan - AIMED
[DSC Europe 23][DigiHealth] Tomislav Krizan - AIMED[DSC Europe 23][DigiHealth] Tomislav Krizan - AIMED
[DSC Europe 23][DigiHealth] Tomislav Krizan - AIMEDDataScienceConferenc1
 
Leukemic stem cells
Leukemic stem cellsLeukemic stem cells
Leukemic stem cellsmds-web
 
Presentation july 31_2015
Presentation july 31_2015Presentation july 31_2015
Presentation july 31_2015gkoytiger
 
Interrogating differences in expression of targeted gene sets to predict brea...
Interrogating differences in expression of targeted gene sets to predict brea...Interrogating differences in expression of targeted gene sets to predict brea...
Interrogating differences in expression of targeted gene sets to predict brea...Enrique Moreno Gonzalez
 

Ähnlich wie Intelligent Systems for Cancer Genomics (AIS305) - AWS re:Invent 2018 (20)

PICS: Pathway Informed Classification System for cancer analysis using gene e...
PICS: Pathway Informed Classification System for cancer analysis using gene e...PICS: Pathway Informed Classification System for cancer analysis using gene e...
PICS: Pathway Informed Classification System for cancer analysis using gene e...
 
정밀의료 시대의 딥러닝
정밀의료 시대의 딥러닝정밀의료 시대의 딥러닝
정밀의료 시대의 딥러닝
 
Microarray CGH
Microarray CGHMicroarray CGH
Microarray CGH
 
Genomics 2015 Keynote - Utilizing cancer sequencing in the clinic
Genomics 2015 Keynote - Utilizing cancer sequencing in the clinicGenomics 2015 Keynote - Utilizing cancer sequencing in the clinic
Genomics 2015 Keynote - Utilizing cancer sequencing in the clinic
 
Biomed central
Biomed centralBiomed central
Biomed central
 
CDAC 2018 Gonzales-Perez interpretation of cancer genomes
CDAC 2018 Gonzales-Perez interpretation of cancer genomesCDAC 2018 Gonzales-Perez interpretation of cancer genomes
CDAC 2018 Gonzales-Perez interpretation of cancer genomes
 
Mastering RNA-Seq (NGS Data Analysis) - A Critical Approach To Transcriptomic...
Mastering RNA-Seq (NGS Data Analysis) - A Critical Approach To Transcriptomic...Mastering RNA-Seq (NGS Data Analysis) - A Critical Approach To Transcriptomic...
Mastering RNA-Seq (NGS Data Analysis) - A Critical Approach To Transcriptomic...
 
Cancer recognition from dna microarray gene expression data using averaged on...
Cancer recognition from dna microarray gene expression data using averaged on...Cancer recognition from dna microarray gene expression data using averaged on...
Cancer recognition from dna microarray gene expression data using averaged on...
 
Visual Exploration of Clinical and Genomic Data for Patient Stratification
Visual Exploration of Clinical and Genomic Data for Patient StratificationVisual Exploration of Clinical and Genomic Data for Patient Stratification
Visual Exploration of Clinical and Genomic Data for Patient Stratification
 
Gene expression profiling reveals molecularly and clinically distinct subtype...
Gene expression profiling reveals molecularly and clinically distinct subtype...Gene expression profiling reveals molecularly and clinically distinct subtype...
Gene expression profiling reveals molecularly and clinically distinct subtype...
 
Applications of Next generation sequencing in Drug Discovery
Applications of Next generation sequencing in Drug DiscoveryApplications of Next generation sequencing in Drug Discovery
Applications of Next generation sequencing in Drug Discovery
 
Next generation Sequencing in Drug Discovery
Next generation Sequencing in Drug DiscoveryNext generation Sequencing in Drug Discovery
Next generation Sequencing in Drug Discovery
 
Applications of microarray
Applications of microarrayApplications of microarray
Applications of microarray
 
QMB_Poster_Tom_Kelly
QMB_Poster_Tom_KellyQMB_Poster_Tom_Kelly
QMB_Poster_Tom_Kelly
 
[DSC Europe 23][DigiHealth] Tomislav Krizan - AIMED
[DSC Europe 23][DigiHealth] Tomislav Krizan - AIMED[DSC Europe 23][DigiHealth] Tomislav Krizan - AIMED
[DSC Europe 23][DigiHealth] Tomislav Krizan - AIMED
 
Leukemic stem cells
Leukemic stem cellsLeukemic stem cells
Leukemic stem cells
 
Pharmacology Powered by Computational Analysis: Predicting Cardiotoxicity of ...
Pharmacology Powered by Computational Analysis: Predicting Cardiotoxicity of ...Pharmacology Powered by Computational Analysis: Predicting Cardiotoxicity of ...
Pharmacology Powered by Computational Analysis: Predicting Cardiotoxicity of ...
 
Presentation july 31_2015
Presentation july 31_2015Presentation july 31_2015
Presentation july 31_2015
 
Utsw 2020 1
Utsw 2020 1Utsw 2020 1
Utsw 2020 1
 
Interrogating differences in expression of targeted gene sets to predict brea...
Interrogating differences in expression of targeted gene sets to predict brea...Interrogating differences in expression of targeted gene sets to predict brea...
Interrogating differences in expression of targeted gene sets to predict brea...
 

Mehr von Amazon Web Services

Come costruire servizi di Forecasting sfruttando algoritmi di ML e deep learn...
Come costruire servizi di Forecasting sfruttando algoritmi di ML e deep learn...Come costruire servizi di Forecasting sfruttando algoritmi di ML e deep learn...
Come costruire servizi di Forecasting sfruttando algoritmi di ML e deep learn...Amazon Web Services
 
Big Data per le Startup: come creare applicazioni Big Data in modalità Server...
Big Data per le Startup: come creare applicazioni Big Data in modalità Server...Big Data per le Startup: come creare applicazioni Big Data in modalità Server...
Big Data per le Startup: come creare applicazioni Big Data in modalità Server...Amazon Web Services
 
Esegui pod serverless con Amazon EKS e AWS Fargate
Esegui pod serverless con Amazon EKS e AWS FargateEsegui pod serverless con Amazon EKS e AWS Fargate
Esegui pod serverless con Amazon EKS e AWS FargateAmazon Web Services
 
Costruire Applicazioni Moderne con AWS
Costruire Applicazioni Moderne con AWSCostruire Applicazioni Moderne con AWS
Costruire Applicazioni Moderne con AWSAmazon Web Services
 
Come spendere fino al 90% in meno con i container e le istanze spot
Come spendere fino al 90% in meno con i container e le istanze spot Come spendere fino al 90% in meno con i container e le istanze spot
Come spendere fino al 90% in meno con i container e le istanze spot Amazon Web Services
 
Rendi unica l’offerta della tua startup sul mercato con i servizi Machine Lea...
Rendi unica l’offerta della tua startup sul mercato con i servizi Machine Lea...Rendi unica l’offerta della tua startup sul mercato con i servizi Machine Lea...
Rendi unica l’offerta della tua startup sul mercato con i servizi Machine Lea...Amazon Web Services
 
OpsWorks Configuration Management: automatizza la gestione e i deployment del...
OpsWorks Configuration Management: automatizza la gestione e i deployment del...OpsWorks Configuration Management: automatizza la gestione e i deployment del...
OpsWorks Configuration Management: automatizza la gestione e i deployment del...Amazon Web Services
 
Microsoft Active Directory su AWS per supportare i tuoi Windows Workloads
Microsoft Active Directory su AWS per supportare i tuoi Windows WorkloadsMicrosoft Active Directory su AWS per supportare i tuoi Windows Workloads
Microsoft Active Directory su AWS per supportare i tuoi Windows WorkloadsAmazon Web Services
 
Database Oracle e VMware Cloud on AWS i miti da sfatare
Database Oracle e VMware Cloud on AWS i miti da sfatareDatabase Oracle e VMware Cloud on AWS i miti da sfatare
Database Oracle e VMware Cloud on AWS i miti da sfatareAmazon Web Services
 
Crea la tua prima serverless ledger-based app con QLDB e NodeJS
Crea la tua prima serverless ledger-based app con QLDB e NodeJSCrea la tua prima serverless ledger-based app con QLDB e NodeJS
Crea la tua prima serverless ledger-based app con QLDB e NodeJSAmazon Web Services
 
API moderne real-time per applicazioni mobili e web
API moderne real-time per applicazioni mobili e webAPI moderne real-time per applicazioni mobili e web
API moderne real-time per applicazioni mobili e webAmazon Web Services
 
Database Oracle e VMware Cloud™ on AWS: i miti da sfatare
Database Oracle e VMware Cloud™ on AWS: i miti da sfatareDatabase Oracle e VMware Cloud™ on AWS: i miti da sfatare
Database Oracle e VMware Cloud™ on AWS: i miti da sfatareAmazon Web Services
 
Tools for building your MVP on AWS
Tools for building your MVP on AWSTools for building your MVP on AWS
Tools for building your MVP on AWSAmazon Web Services
 
How to Build a Winning Pitch Deck
How to Build a Winning Pitch DeckHow to Build a Winning Pitch Deck
How to Build a Winning Pitch DeckAmazon Web Services
 
Building a web application without servers
Building a web application without serversBuilding a web application without servers
Building a web application without serversAmazon Web Services
 
AWS_HK_StartupDay_Building Interactive websites while automating for efficien...
AWS_HK_StartupDay_Building Interactive websites while automating for efficien...AWS_HK_StartupDay_Building Interactive websites while automating for efficien...
AWS_HK_StartupDay_Building Interactive websites while automating for efficien...Amazon Web Services
 
Introduzione a Amazon Elastic Container Service
Introduzione a Amazon Elastic Container ServiceIntroduzione a Amazon Elastic Container Service
Introduzione a Amazon Elastic Container ServiceAmazon Web Services
 

Mehr von Amazon Web Services (20)

Come costruire servizi di Forecasting sfruttando algoritmi di ML e deep learn...
Come costruire servizi di Forecasting sfruttando algoritmi di ML e deep learn...Come costruire servizi di Forecasting sfruttando algoritmi di ML e deep learn...
Come costruire servizi di Forecasting sfruttando algoritmi di ML e deep learn...
 
Big Data per le Startup: come creare applicazioni Big Data in modalità Server...
Big Data per le Startup: come creare applicazioni Big Data in modalità Server...Big Data per le Startup: come creare applicazioni Big Data in modalità Server...
Big Data per le Startup: come creare applicazioni Big Data in modalità Server...
 
Esegui pod serverless con Amazon EKS e AWS Fargate
Esegui pod serverless con Amazon EKS e AWS FargateEsegui pod serverless con Amazon EKS e AWS Fargate
Esegui pod serverless con Amazon EKS e AWS Fargate
 
Costruire Applicazioni Moderne con AWS
Costruire Applicazioni Moderne con AWSCostruire Applicazioni Moderne con AWS
Costruire Applicazioni Moderne con AWS
 
Come spendere fino al 90% in meno con i container e le istanze spot
Come spendere fino al 90% in meno con i container e le istanze spot Come spendere fino al 90% in meno con i container e le istanze spot
Come spendere fino al 90% in meno con i container e le istanze spot
 
Open banking as a service
Open banking as a serviceOpen banking as a service
Open banking as a service
 
Rendi unica l’offerta della tua startup sul mercato con i servizi Machine Lea...
Rendi unica l’offerta della tua startup sul mercato con i servizi Machine Lea...Rendi unica l’offerta della tua startup sul mercato con i servizi Machine Lea...
Rendi unica l’offerta della tua startup sul mercato con i servizi Machine Lea...
 
OpsWorks Configuration Management: automatizza la gestione e i deployment del...
OpsWorks Configuration Management: automatizza la gestione e i deployment del...OpsWorks Configuration Management: automatizza la gestione e i deployment del...
OpsWorks Configuration Management: automatizza la gestione e i deployment del...
 
Microsoft Active Directory su AWS per supportare i tuoi Windows Workloads
Microsoft Active Directory su AWS per supportare i tuoi Windows WorkloadsMicrosoft Active Directory su AWS per supportare i tuoi Windows Workloads
Microsoft Active Directory su AWS per supportare i tuoi Windows Workloads
 
Computer Vision con AWS
Computer Vision con AWSComputer Vision con AWS
Computer Vision con AWS
 
Database Oracle e VMware Cloud on AWS i miti da sfatare
Database Oracle e VMware Cloud on AWS i miti da sfatareDatabase Oracle e VMware Cloud on AWS i miti da sfatare
Database Oracle e VMware Cloud on AWS i miti da sfatare
 
Crea la tua prima serverless ledger-based app con QLDB e NodeJS
Crea la tua prima serverless ledger-based app con QLDB e NodeJSCrea la tua prima serverless ledger-based app con QLDB e NodeJS
Crea la tua prima serverless ledger-based app con QLDB e NodeJS
 
API moderne real-time per applicazioni mobili e web
API moderne real-time per applicazioni mobili e webAPI moderne real-time per applicazioni mobili e web
API moderne real-time per applicazioni mobili e web
 
Database Oracle e VMware Cloud™ on AWS: i miti da sfatare
Database Oracle e VMware Cloud™ on AWS: i miti da sfatareDatabase Oracle e VMware Cloud™ on AWS: i miti da sfatare
Database Oracle e VMware Cloud™ on AWS: i miti da sfatare
 
Tools for building your MVP on AWS
Tools for building your MVP on AWSTools for building your MVP on AWS
Tools for building your MVP on AWS
 
How to Build a Winning Pitch Deck
How to Build a Winning Pitch DeckHow to Build a Winning Pitch Deck
How to Build a Winning Pitch Deck
 
Building a web application without servers
Building a web application without serversBuilding a web application without servers
Building a web application without servers
 
Fundraising Essentials
Fundraising EssentialsFundraising Essentials
Fundraising Essentials
 
AWS_HK_StartupDay_Building Interactive websites while automating for efficien...
AWS_HK_StartupDay_Building Interactive websites while automating for efficien...AWS_HK_StartupDay_Building Interactive websites while automating for efficien...
AWS_HK_StartupDay_Building Interactive websites while automating for efficien...
 
Introduzione a Amazon Elastic Container Service
Introduzione a Amazon Elastic Container ServiceIntroduzione a Amazon Elastic Container Service
Introduzione a Amazon Elastic Container Service
 

Intelligent Systems for Cancer Genomics (AIS305) - AWS re:Invent 2018