SlideShare ist ein Scribd-Unternehmen logo
1 von 26
Society of St. Andrew
gleaning america’s fields,
feeding america’s hungry

Why is so much good food
available to glean and distribute to
the hungry?

Take our quiz to see if you
know why!
These beans are headed
for a landfill. What’s
wrong with them?
A. They are not fresh.

B. Nobody likes green beans.
C. They are the wrong length.
D. They have botulism spores.
A. They are not fresh.

B. Nobody likes green beans.
C. They are the wrong length.
D. They have botulism spores.
These strawberries are
headed for a landfill.
What’s wrong with them?
A. Strawberries are too messy.

B. They have an insect problem.
C. Somebody dropped them.
D. The farm closed for the season.
A. Strawberries are too messy.

B. They have an insect problem.
C. Somebody dropped them.
D. The farm closed for the season.
These potatoes are headed
for a landfill. What’s
wrong with them?
A. They are moldy.

B. They have blemishes.
C. Bird’s Eye changed packaging.
D. People prefer 5-lb bags.
A. They are moldy.

B. They have blemishes.
C. Bird’s Eye changed packaging.
D. People prefer 5-lb bags.
These potatoes are headed
for a landfill. What’s
wrong with them?
A. They were delivered to the
wrong place.
B. The flavor is off.

C. They are last year’s potatoes.
D. They are the wrong shape.
A. They were delivered to the
wrong place.
B. The flavor is off.

C. They are last year’s potatoes.
D. They are the wrong shape.
This corn is headed for a
landfill. What’s
wrong with it?
A. They were the second and third
ears on each stalk.
B. They have pesticide residue.

C. The ears are wormy.
D. They fell off the truck.
A. They were the second and third
ears on each stalk.
B. They have pesticide residue.

C. The ears are wormy.
D. They fell off the truck.
These tomatoes are headed
for a landfill. What’s
wrong with them?
A. They weren’t refrigerated.

B. They are misshapen.
C. They are too ripe.
D. They are squished.
A. They weren’t refrigerated.

B. They are misshapen.
C. They are too ripe.
D. They are squished.
These peaches are headed
for a landfill. What’s
wrong with them?
A. They were overlooked at
harvest.
B. They are bruised.

C. They didn’t get sold.
D. They are too big.
A. They were overlooked at
harvest.
B. They are bruised.

C. They didn’t get sold.
D. They are too big.
Meanwhile,
50 million Americans
struggle to put food on
their tables.
In 2012, with the help of
40,300 volunteers
the Society of St. Andrew put
100 million servings
of fresh fruits and vegetables on
the tables of people at risk
for hunger across the US
Society of St. Andrew
3383 Sweet Hollow Road
Big Island, VA 24526

800-333-4597
Look for us on Facebook & Twitter!

ENDhunger.org

Weitere ähnliche Inhalte

Was ist angesagt?

Was ist angesagt? (17)

Mother Nature Festival
Mother Nature FestivalMother Nature Festival
Mother Nature Festival
 
Boulevard Food Co-Op
Boulevard Food Co-OpBoulevard Food Co-Op
Boulevard Food Co-Op
 
How Much Water (And Money) Does a Leaky Faucet Waste?
How Much Water (And Money) Does a Leaky Faucet Waste?How Much Water (And Money) Does a Leaky Faucet Waste?
How Much Water (And Money) Does a Leaky Faucet Waste?
 
Week 7 CH Presentation
Week 7 CH PresentationWeek 7 CH Presentation
Week 7 CH Presentation
 
Owl_Poster_2016-3
Owl_Poster_2016-3Owl_Poster_2016-3
Owl_Poster_2016-3
 
2014 Conference - Gretchen LeBuhn from SF State
2014 Conference - Gretchen LeBuhn from SF State2014 Conference - Gretchen LeBuhn from SF State
2014 Conference - Gretchen LeBuhn from SF State
 
JMCAP Thanksgiving Event 2015
JMCAP Thanksgiving Event 2015JMCAP Thanksgiving Event 2015
JMCAP Thanksgiving Event 2015
 
Virginia Farm-to-School Week: Growing from the Grassroots
Virginia Farm-to-School Week: Growing from the GrassrootsVirginia Farm-to-School Week: Growing from the Grassroots
Virginia Farm-to-School Week: Growing from the Grassroots
 
To B or Not To B
To B or Not To BTo B or Not To B
To B or Not To B
 
What is DC Local Flavor Week?
What is DC Local Flavor Week?What is DC Local Flavor Week?
What is DC Local Flavor Week?
 
Oxfam Launches East Africa Appeal for Starving People
Oxfam Launches East Africa Appeal for Starving PeopleOxfam Launches East Africa Appeal for Starving People
Oxfam Launches East Africa Appeal for Starving People
 
5,525 Cig. Butts
5,525 Cig. Butts5,525 Cig. Butts
5,525 Cig. Butts
 
Excellent Conference Summary from a Participant
Excellent Conference Summary from a ParticipantExcellent Conference Summary from a Participant
Excellent Conference Summary from a Participant
 
Wwd presentation
Wwd presentationWwd presentation
Wwd presentation
 
Wwd presentation
Wwd presentationWwd presentation
Wwd presentation
 
Books and events
Books and eventsBooks and events
Books and events
 
Compassion Sunday 2017 - Calvary Syracuse
Compassion Sunday 2017 - Calvary SyracuseCompassion Sunday 2017 - Calvary Syracuse
Compassion Sunday 2017 - Calvary Syracuse
 

Andere mochten auch

Quantitative Questionnaire
Quantitative QuestionnaireQuantitative Questionnaire
Quantitative Questionnairesaujanya94
 
Be Part of the Party to Celebrate the International Year of Pulses: Dry Beans...
Be Part of the Party to Celebrate the International Year of Pulses: Dry Beans...Be Part of the Party to Celebrate the International Year of Pulses: Dry Beans...
Be Part of the Party to Celebrate the International Year of Pulses: Dry Beans...Alice Henneman
 
BASIC INFO ON FUDUS FLORESCENCE ANGIOGRAPHY
BASIC INFO ON FUDUS FLORESCENCE ANGIOGRAPHYBASIC INFO ON FUDUS FLORESCENCE ANGIOGRAPHY
BASIC INFO ON FUDUS FLORESCENCE ANGIOGRAPHYNalin Nayan
 
fundus flourescien angiography
fundus flourescien angiographyfundus flourescien angiography
fundus flourescien angiographyVASIUR RAHMAN
 
Fundus Fluorescein Angiography
   Fundus Fluorescein Angiography   Fundus Fluorescein Angiography
Fundus Fluorescein Angiographykopila kafle
 
Fluorescein in Ophthalmology
Fluorescein in OphthalmologyFluorescein in Ophthalmology
Fluorescein in OphthalmologySamuel Ponraj
 
Air pollution: its causes,effects and pollutants
Air pollution: its causes,effects and pollutantsAir pollution: its causes,effects and pollutants
Air pollution: its causes,effects and pollutantsMaliha Eesha
 

Andere mochten auch (11)

التقديم و التأخير
التقديم و التأخيرالتقديم و التأخير
التقديم و التأخير
 
Wasted food-ip usa 2012
Wasted food-ip usa  2012Wasted food-ip usa  2012
Wasted food-ip usa 2012
 
Quantitative Questionnaire
Quantitative QuestionnaireQuantitative Questionnaire
Quantitative Questionnaire
 
Fundus Fluorescein Angiography
Fundus  Fluorescein AngiographyFundus  Fluorescein Angiography
Fundus Fluorescein Angiography
 
Be Part of the Party to Celebrate the International Year of Pulses: Dry Beans...
Be Part of the Party to Celebrate the International Year of Pulses: Dry Beans...Be Part of the Party to Celebrate the International Year of Pulses: Dry Beans...
Be Part of the Party to Celebrate the International Year of Pulses: Dry Beans...
 
BASIC INFO ON FUDUS FLORESCENCE ANGIOGRAPHY
BASIC INFO ON FUDUS FLORESCENCE ANGIOGRAPHYBASIC INFO ON FUDUS FLORESCENCE ANGIOGRAPHY
BASIC INFO ON FUDUS FLORESCENCE ANGIOGRAPHY
 
fundus flourescien angiography
fundus flourescien angiographyfundus flourescien angiography
fundus flourescien angiography
 
Fundus Fluorescein Angiography
   Fundus Fluorescein Angiography   Fundus Fluorescein Angiography
Fundus Fluorescein Angiography
 
Fluorescein in Ophthalmology
Fluorescein in OphthalmologyFluorescein in Ophthalmology
Fluorescein in Ophthalmology
 
Air pollution: its causes,effects and pollutants
Air pollution: its causes,effects and pollutantsAir pollution: its causes,effects and pollutants
Air pollution: its causes,effects and pollutants
 
Air pollution final.ppt
Air pollution final.pptAir pollution final.ppt
Air pollution final.ppt
 

Ähnlich wie Ppt for ffa

pronoun -----agreement for primary s.ppt
pronoun -----agreement for primary s.pptpronoun -----agreement for primary s.ppt
pronoun -----agreement for primary s.pptFghhGhjkl
 
Phil iri english 6
Phil iri english 6Phil iri english 6
Phil iri english 6Berth Daylo
 
fhcgvjblkhj.iouilkdcghvhhlksvagreement.ppt
fhcgvjblkhj.iouilkdcghvhhlksvagreement.pptfhcgvjblkhj.iouilkdcghvhhlksvagreement.ppt
fhcgvjblkhj.iouilkdcghvhhlksvagreement.pptAlangilanHigh
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.pptJimmiChunk
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.pptMnMVlog
 
Subject verb Agreement presentation for Students
Subject verb Agreement presentation for StudentsSubject verb Agreement presentation for Students
Subject verb Agreement presentation for Studentslogusps1999
 
K to 12 Grade 3 LAPG Reviewer
K to 12 Grade 3 LAPG ReviewerK to 12 Grade 3 LAPG Reviewer
K to 12 Grade 3 LAPG ReviewerLiGhT ArOhL
 
2023-03-25 Composting at Home 101 without link to voucher.pptx
2023-03-25 Composting at Home 101 without link to voucher.pptx2023-03-25 Composting at Home 101 without link to voucher.pptx
2023-03-25 Composting at Home 101 without link to voucher.pptxEllen Book
 
2023-05-27 Composting at Home 101 without voucher link.pptx
2023-05-27 Composting at Home 101 without voucher link.pptx2023-05-27 Composting at Home 101 without voucher link.pptx
2023-05-27 Composting at Home 101 without voucher link.pptxEllen Book
 
2023-05-27 Composting at Home 101 without voucher link.pptx
2023-05-27 Composting at Home 101 without voucher link.pptx2023-05-27 Composting at Home 101 without voucher link.pptx
2023-05-27 Composting at Home 101 without voucher link.pptxEllen Book
 

Ähnlich wie Ppt for ffa (14)

CONTEXT CLLUES.pptx
CONTEXT CLLUES.pptxCONTEXT CLLUES.pptx
CONTEXT CLLUES.pptx
 
pronoun -----agreement for primary s.ppt
pronoun -----agreement for primary s.pptpronoun -----agreement for primary s.ppt
pronoun -----agreement for primary s.ppt
 
Phil iri english 6
Phil iri english 6Phil iri english 6
Phil iri english 6
 
fhcgvjblkhj.iouilkdcghvhhlksvagreement.ppt
fhcgvjblkhj.iouilkdcghvhhlksvagreement.pptfhcgvjblkhj.iouilkdcghvhhlksvagreement.ppt
fhcgvjblkhj.iouilkdcghvhhlksvagreement.ppt
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
Subject verb Agreement presentation for Students
Subject verb Agreement presentation for StudentsSubject verb Agreement presentation for Students
Subject verb Agreement presentation for Students
 
K to 12 Grade 3 LAPG Reviewer
K to 12 Grade 3 LAPG ReviewerK to 12 Grade 3 LAPG Reviewer
K to 12 Grade 3 LAPG Reviewer
 
2023-03-25 Composting at Home 101 without link to voucher.pptx
2023-03-25 Composting at Home 101 without link to voucher.pptx2023-03-25 Composting at Home 101 without link to voucher.pptx
2023-03-25 Composting at Home 101 without link to voucher.pptx
 
2023-05-27 Composting at Home 101 without voucher link.pptx
2023-05-27 Composting at Home 101 without voucher link.pptx2023-05-27 Composting at Home 101 without voucher link.pptx
2023-05-27 Composting at Home 101 without voucher link.pptx
 
2023-05-27 Composting at Home 101 without voucher link.pptx
2023-05-27 Composting at Home 101 without voucher link.pptx2023-05-27 Composting at Home 101 without voucher link.pptx
2023-05-27 Composting at Home 101 without voucher link.pptx
 

Kürzlich hochgeladen

mini mental status format.docx
mini    mental       status     format.docxmini    mental       status     format.docx
mini mental status format.docxPoojaSen20
 
Beyond the EU: DORA and NIS 2 Directive's Global Impact
Beyond the EU: DORA and NIS 2 Directive's Global ImpactBeyond the EU: DORA and NIS 2 Directive's Global Impact
Beyond the EU: DORA and NIS 2 Directive's Global ImpactPECB
 
Measures of Central Tendency: Mean, Median and Mode
Measures of Central Tendency: Mean, Median and ModeMeasures of Central Tendency: Mean, Median and Mode
Measures of Central Tendency: Mean, Median and ModeThiyagu K
 
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...EduSkills OECD
 
Q4-W6-Restating Informational Text Grade 3
Q4-W6-Restating Informational Text Grade 3Q4-W6-Restating Informational Text Grade 3
Q4-W6-Restating Informational Text Grade 3JemimahLaneBuaron
 
A Critique of the Proposed National Education Policy Reform
A Critique of the Proposed National Education Policy ReformA Critique of the Proposed National Education Policy Reform
A Critique of the Proposed National Education Policy ReformChameera Dedduwage
 
Z Score,T Score, Percential Rank and Box Plot Graph
Z Score,T Score, Percential Rank and Box Plot GraphZ Score,T Score, Percential Rank and Box Plot Graph
Z Score,T Score, Percential Rank and Box Plot GraphThiyagu K
 
1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 -  Danh muc Sach Giao Khoa 10 . pdf1029 -  Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdfQucHHunhnh
 
Software Engineering Methodologies (overview)
Software Engineering Methodologies (overview)Software Engineering Methodologies (overview)
Software Engineering Methodologies (overview)eniolaolutunde
 
Paris 2024 Olympic Geographies - an activity
Paris 2024 Olympic Geographies - an activityParis 2024 Olympic Geographies - an activity
Paris 2024 Olympic Geographies - an activityGeoBlogs
 
Separation of Lanthanides/ Lanthanides and Actinides
Separation of Lanthanides/ Lanthanides and ActinidesSeparation of Lanthanides/ Lanthanides and Actinides
Separation of Lanthanides/ Lanthanides and ActinidesFatimaKhan178732
 
Student login on Anyboli platform.helpin
Student login on Anyboli platform.helpinStudent login on Anyboli platform.helpin
Student login on Anyboli platform.helpinRaunakKeshri1
 
Web & Social Media Analytics Previous Year Question Paper.pdf
Web & Social Media Analytics Previous Year Question Paper.pdfWeb & Social Media Analytics Previous Year Question Paper.pdf
Web & Social Media Analytics Previous Year Question Paper.pdfJayanti Pande
 
CARE OF CHILD IN INCUBATOR..........pptx
CARE OF CHILD IN INCUBATOR..........pptxCARE OF CHILD IN INCUBATOR..........pptx
CARE OF CHILD IN INCUBATOR..........pptxGaneshChakor2
 
URLs and Routing in the Odoo 17 Website App
URLs and Routing in the Odoo 17 Website AppURLs and Routing in the Odoo 17 Website App
URLs and Routing in the Odoo 17 Website AppCeline George
 
Introduction to ArtificiaI Intelligence in Higher Education
Introduction to ArtificiaI Intelligence in Higher EducationIntroduction to ArtificiaI Intelligence in Higher Education
Introduction to ArtificiaI Intelligence in Higher Educationpboyjonauth
 

Kürzlich hochgeladen (20)

mini mental status format.docx
mini    mental       status     format.docxmini    mental       status     format.docx
mini mental status format.docx
 
Staff of Color (SOC) Retention Efforts DDSD
Staff of Color (SOC) Retention Efforts DDSDStaff of Color (SOC) Retention Efforts DDSD
Staff of Color (SOC) Retention Efforts DDSD
 
Beyond the EU: DORA and NIS 2 Directive's Global Impact
Beyond the EU: DORA and NIS 2 Directive's Global ImpactBeyond the EU: DORA and NIS 2 Directive's Global Impact
Beyond the EU: DORA and NIS 2 Directive's Global Impact
 
Measures of Central Tendency: Mean, Median and Mode
Measures of Central Tendency: Mean, Median and ModeMeasures of Central Tendency: Mean, Median and Mode
Measures of Central Tendency: Mean, Median and Mode
 
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
 
Q4-W6-Restating Informational Text Grade 3
Q4-W6-Restating Informational Text Grade 3Q4-W6-Restating Informational Text Grade 3
Q4-W6-Restating Informational Text Grade 3
 
A Critique of the Proposed National Education Policy Reform
A Critique of the Proposed National Education Policy ReformA Critique of the Proposed National Education Policy Reform
A Critique of the Proposed National Education Policy Reform
 
Z Score,T Score, Percential Rank and Box Plot Graph
Z Score,T Score, Percential Rank and Box Plot GraphZ Score,T Score, Percential Rank and Box Plot Graph
Z Score,T Score, Percential Rank and Box Plot Graph
 
INDIA QUIZ 2024 RLAC DELHI UNIVERSITY.pptx
INDIA QUIZ 2024 RLAC DELHI UNIVERSITY.pptxINDIA QUIZ 2024 RLAC DELHI UNIVERSITY.pptx
INDIA QUIZ 2024 RLAC DELHI UNIVERSITY.pptx
 
1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 -  Danh muc Sach Giao Khoa 10 . pdf1029 -  Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdf
 
Mattingly "AI & Prompt Design: The Basics of Prompt Design"
Mattingly "AI & Prompt Design: The Basics of Prompt Design"Mattingly "AI & Prompt Design: The Basics of Prompt Design"
Mattingly "AI & Prompt Design: The Basics of Prompt Design"
 
Mattingly "AI & Prompt Design: Structured Data, Assistants, & RAG"
Mattingly "AI & Prompt Design: Structured Data, Assistants, & RAG"Mattingly "AI & Prompt Design: Structured Data, Assistants, & RAG"
Mattingly "AI & Prompt Design: Structured Data, Assistants, & RAG"
 
Software Engineering Methodologies (overview)
Software Engineering Methodologies (overview)Software Engineering Methodologies (overview)
Software Engineering Methodologies (overview)
 
Paris 2024 Olympic Geographies - an activity
Paris 2024 Olympic Geographies - an activityParis 2024 Olympic Geographies - an activity
Paris 2024 Olympic Geographies - an activity
 
Separation of Lanthanides/ Lanthanides and Actinides
Separation of Lanthanides/ Lanthanides and ActinidesSeparation of Lanthanides/ Lanthanides and Actinides
Separation of Lanthanides/ Lanthanides and Actinides
 
Student login on Anyboli platform.helpin
Student login on Anyboli platform.helpinStudent login on Anyboli platform.helpin
Student login on Anyboli platform.helpin
 
Web & Social Media Analytics Previous Year Question Paper.pdf
Web & Social Media Analytics Previous Year Question Paper.pdfWeb & Social Media Analytics Previous Year Question Paper.pdf
Web & Social Media Analytics Previous Year Question Paper.pdf
 
CARE OF CHILD IN INCUBATOR..........pptx
CARE OF CHILD IN INCUBATOR..........pptxCARE OF CHILD IN INCUBATOR..........pptx
CARE OF CHILD IN INCUBATOR..........pptx
 
URLs and Routing in the Odoo 17 Website App
URLs and Routing in the Odoo 17 Website AppURLs and Routing in the Odoo 17 Website App
URLs and Routing in the Odoo 17 Website App
 
Introduction to ArtificiaI Intelligence in Higher Education
Introduction to ArtificiaI Intelligence in Higher EducationIntroduction to ArtificiaI Intelligence in Higher Education
Introduction to ArtificiaI Intelligence in Higher Education
 

Ppt for ffa

  • 1. Society of St. Andrew gleaning america’s fields, feeding america’s hungry Why is so much good food available to glean and distribute to the hungry? Take our quiz to see if you know why!
  • 2. These beans are headed for a landfill. What’s wrong with them?
  • 3. A. They are not fresh. B. Nobody likes green beans. C. They are the wrong length. D. They have botulism spores.
  • 4. A. They are not fresh. B. Nobody likes green beans. C. They are the wrong length. D. They have botulism spores.
  • 5. These strawberries are headed for a landfill. What’s wrong with them?
  • 6. A. Strawberries are too messy. B. They have an insect problem. C. Somebody dropped them. D. The farm closed for the season.
  • 7. A. Strawberries are too messy. B. They have an insect problem. C. Somebody dropped them. D. The farm closed for the season.
  • 8. These potatoes are headed for a landfill. What’s wrong with them?
  • 9. A. They are moldy. B. They have blemishes. C. Bird’s Eye changed packaging. D. People prefer 5-lb bags.
  • 10. A. They are moldy. B. They have blemishes. C. Bird’s Eye changed packaging. D. People prefer 5-lb bags.
  • 11. These potatoes are headed for a landfill. What’s wrong with them?
  • 12. A. They were delivered to the wrong place. B. The flavor is off. C. They are last year’s potatoes. D. They are the wrong shape.
  • 13. A. They were delivered to the wrong place. B. The flavor is off. C. They are last year’s potatoes. D. They are the wrong shape.
  • 14.
  • 15. This corn is headed for a landfill. What’s wrong with it?
  • 16. A. They were the second and third ears on each stalk. B. They have pesticide residue. C. The ears are wormy. D. They fell off the truck.
  • 17. A. They were the second and third ears on each stalk. B. They have pesticide residue. C. The ears are wormy. D. They fell off the truck.
  • 18. These tomatoes are headed for a landfill. What’s wrong with them?
  • 19. A. They weren’t refrigerated. B. They are misshapen. C. They are too ripe. D. They are squished.
  • 20. A. They weren’t refrigerated. B. They are misshapen. C. They are too ripe. D. They are squished.
  • 21. These peaches are headed for a landfill. What’s wrong with them?
  • 22. A. They were overlooked at harvest. B. They are bruised. C. They didn’t get sold. D. They are too big.
  • 23. A. They were overlooked at harvest. B. They are bruised. C. They didn’t get sold. D. They are too big.
  • 24. Meanwhile, 50 million Americans struggle to put food on their tables.
  • 25. In 2012, with the help of 40,300 volunteers the Society of St. Andrew put 100 million servings of fresh fruits and vegetables on the tables of people at risk for hunger across the US
  • 26. Society of St. Andrew 3383 Sweet Hollow Road Big Island, VA 24526 800-333-4597 Look for us on Facebook & Twitter! ENDhunger.org