Soc 451, 4th class

SOC 451
Globalization of Culture and
Communication
Global Political Structures and
Processes
Asst. Prof. Fatma Altınbaş Sarıgül
Understanding of Contemporary Globalization
• The global flow of people- refugees, illegal
immigrants
• Dwindling oil and water supply
• Economic flows dominated by MNCs.
• Economic and financial crisis
• Environmental problems-Global warming
• Diseases- Malaria, AIDS, etc.
• War
• Global Inequalities
• Terrorism
THE NATION-STATE
• The Treaty of Westphalia (1648) ended the Thirty and
Eighty Years Wars in Europe and instituted an
international system which recognized sovereign
states as its core.
Nation: Social group linked through common descent, culture,
language or territorial contiguity. (Cerny 2007:854)
National Identity:A fluid and dynamic form of collective identity;
members of the community believe that they are different from other
groups.
Nationalism: Doctrine and political movement that seek to make the
nation the basis of a political structure.
State: The new institutional form after the fuedal systemi offers a
more centralized form of control.
Nation-state: Integrates sub-groups that define themselves as a nation
with the organizational structure that constituted the states
Threats to the Nation-States
• The global economy and global economic flows
• Flows of information
• Illegal immigrants
• New Social Movements
• Terrorists
• Money and Drug Traffic
• The growing power of global and transnational
organizations
• The growth of global problems
• Growing interest in international human rights
International Human Rights
• The Declaration of International Human Rights
states that human rights take precedence over
the nation-state and that the UN is seeking
control over the state on these issues.
• The International Criminal Court (ICC) in 2002,
created a venue in which those accused of
human rights abuses could be tried and found
guilty.
THE NATION-STATE
• It is still the major player on the global stage,
but it retains some power in the face of
globalization.
• Some scholars argue that the issues which
may be seen as threats to nation-states are
also the issues which increase the power of
the nation-states.
IMMAGINED COMMUNITY
(Benedict Anderson)
• Nation-state is not a ‘natural’ phenomenon but is
rather a social an political construction.
• Anderson’s theory of ‘Immagined Community’
states that a nation primarily exists within the
realm of ideas.
• The idea of nation and nationalism is linked to
two developments- the modern novel and the
modern newspaper.
• It was the mass sale and distribution of novels
and newspapers that was critical to the rise of the
imagined nation.
Changes in Global Nation-State Relations
• International Relations during WWII;
The Allies ( US, Great Britain, France, Russia)
The Axis (Germany, Japan, Italy)
• During the Cold War;
Soviet Bloc countries and West
• Contemporary Question:
How about international relations of the new
global political world?
Changes in Global Nation-State Relations
• New Big Three in the World:
The EU, China and the US.
• Why EU is important?
• Why China is important?
• What about Russia?
• Second World nations on the way;
Turkey, Kazakhstan, Venezuela, Brazil, Saudi
Arabia, Iran, Malaysia, Thailand.
Global Political Institutions
• League of Nations
• United Nations (UN)
• United Nations Conference on Trade and
Development (UNCTAD)
• United Nations Educational, Scientific and
Cultural Organization (UNESCO)
• International Atomic Energy Agency (IAEA)
• G8 Nations- France, Germany, Italy, Japan,
United Kingdom, US, Russia, Canada.
Soc 451, 4th class
Soc 451, 4th class
1 von 12

Recomendados

Soc 451, 2nd class von
Soc 451, 2nd classSoc 451, 2nd class
Soc 451, 2nd classglobalizationofculture
1.4K views15 Folien
Soc 451, 3rd class von
Soc 451, 3rd classSoc 451, 3rd class
Soc 451, 3rd classglobalizationofculture
736 views21 Folien
Soc 451, 7th class von
Soc 451, 7th classSoc 451, 7th class
Soc 451, 7th classglobalizationofculture
536 views18 Folien
Soc 451, 9th class von
Soc 451, 9th classSoc 451, 9th class
Soc 451, 9th classglobalizationofculture
395 views12 Folien
Soc 451, 5th class part 1 von
Soc 451, 5th class part 1Soc 451, 5th class part 1
Soc 451, 5th class part 1globalizationofculture
455 views8 Folien
Soc 451, 1st class von
Soc 451, 1st classSoc 451, 1st class
Soc 451, 1st classglobalizationofculture
22.3K views21 Folien

Más contenido relacionado

Was ist angesagt?

Globalization Theory von
Globalization TheoryGlobalization Theory
Globalization TheoryKhenddro Low
55.4K views47 Folien
The World Horizon Opens Up: on the Sociology of Globalization von
The World Horizon Opens Up: on the Sociology of Globalization The World Horizon Opens Up: on the Sociology of Globalization
The World Horizon Opens Up: on the Sociology of Globalization University Of Manchester
1.3K views6 Folien
Change von
ChangeChange
ChangeChristian Villanueva
463 views26 Folien
Modernization theory von
Modernization theoryModernization theory
Modernization theoryMisbah Munir
27.6K views13 Folien
Regional economic development von
Regional economic development Regional economic development
Regional economic development Nor Hashimah
83 views8 Folien
Modernization Theory von
Modernization TheoryModernization Theory
Modernization TheoryChristopher Rice
33.9K views32 Folien

Was ist angesagt?(20)

Globalization Theory von Khenddro Low
Globalization TheoryGlobalization Theory
Globalization Theory
Khenddro Low 55.4K views
Modernization theory von Misbah Munir
Modernization theoryModernization theory
Modernization theory
Misbah Munir27.6K views
Regional economic development von Nor Hashimah
Regional economic development Regional economic development
Regional economic development
Nor Hashimah83 views
A homogeneous society is such a society where most of the people share the sa... von hanan ampaso
A homogeneous society is such a society where most of the people share the sa...A homogeneous society is such a society where most of the people share the sa...
A homogeneous society is such a society where most of the people share the sa...
hanan ampaso8.5K views
Globalization: A Threat to Cultural Diversity? von Larissa Prokopenko
Globalization: A Threat to Cultural Diversity?Globalization: A Threat to Cultural Diversity?
Globalization: A Threat to Cultural Diversity?
Larissa Prokopenko6.5K views
GLOBALISATION-CULTURAL AND SOCIAL von Ankur Goyal
GLOBALISATION-CULTURAL AND SOCIAL GLOBALISATION-CULTURAL AND SOCIAL
GLOBALISATION-CULTURAL AND SOCIAL
Ankur Goyal5.9K views
Clash Of Cultures von mragab
Clash Of CulturesClash Of Cultures
Clash Of Cultures
mragab3.9K views
Globalization Theory Revised1 von Khenddro Low
Globalization Theory Revised1Globalization Theory Revised1
Globalization Theory Revised1
Khenddro Low 28.9K views
101 Globalisation And Culture von guest3f4d16
101 Globalisation And Culture101 Globalisation And Culture
101 Globalisation And Culture
guest3f4d163.3K views
Cultural Imperialism by Abid Zafar von Abid Zafar
Cultural Imperialism by Abid ZafarCultural Imperialism by Abid Zafar
Cultural Imperialism by Abid Zafar
Abid Zafar7.4K views
Weaknesses and strenths of modernization theory von Wanyonyi Joseph
Weaknesses and strenths of modernization theoryWeaknesses and strenths of modernization theory
Weaknesses and strenths of modernization theory
Wanyonyi Joseph94.5K views
Media Imperalism and Development von Leslie Chan
Media Imperalism and DevelopmentMedia Imperalism and Development
Media Imperalism and Development
Leslie Chan2.1K views
Globalization & the Clash of Civilizations von Boutkhil Guemide
Globalization & the Clash of Civilizations Globalization & the Clash of Civilizations
Globalization & the Clash of Civilizations
Boutkhil Guemide1.1K views
Trends, Network and Critical Thinking Unit 3 Global Networks Labor and Migration von Eman Bustamante
Trends, Network and Critical Thinking Unit 3 Global Networks Labor and MigrationTrends, Network and Critical Thinking Unit 3 Global Networks Labor and Migration
Trends, Network and Critical Thinking Unit 3 Global Networks Labor and Migration
Eman Bustamante11.6K views
6 Cultural Integration von Ecumene
6 Cultural Integration6 Cultural Integration
6 Cultural Integration
Ecumene 29.7K views

Destacado

Module 1 - Peace and Conflict in an Interdependent World von
Module 1 - Peace and Conflict in an Interdependent WorldModule 1 - Peace and Conflict in an Interdependent World
Module 1 - Peace and Conflict in an Interdependent WorldAngélica Ruiz León
2.4K views89 Folien
Chapter1 von
Chapter1Chapter1
Chapter1Charles Cooper
573 views46 Folien
Early Modernity von
Early ModernityEarly Modernity
Early ModernityJonathan Dresner
1.4K views9 Folien
Social Change in Late Modernity 07 von
Social Change in Late Modernity 07Social Change in Late Modernity 07
Social Change in Late Modernity 07Clive McGoun
264 views10 Folien
Doc6 von
Doc6Doc6
Doc6Natalia Martinez
271 views1 Folie
Week 2 modernism & post modernism von
Week 2 modernism & post modernismWeek 2 modernism & post modernism
Week 2 modernism & post modernismleighmedia
1.2K views12 Folien

Destacado(20)

Module 1 - Peace and Conflict in an Interdependent World von Angélica Ruiz León
Module 1 - Peace and Conflict in an Interdependent WorldModule 1 - Peace and Conflict in an Interdependent World
Module 1 - Peace and Conflict in an Interdependent World
Social Change in Late Modernity 07 von Clive McGoun
Social Change in Late Modernity 07Social Change in Late Modernity 07
Social Change in Late Modernity 07
Clive McGoun264 views
Week 2 modernism & post modernism von leighmedia
Week 2 modernism & post modernismWeek 2 modernism & post modernism
Week 2 modernism & post modernism
leighmedia1.2K views
Social Change in Late Modernity 01 von Clive McGoun
Social Change in Late Modernity 01Social Change in Late Modernity 01
Social Change in Late Modernity 01
Clive McGoun599 views
Raves week 5_paul von Deleuze78
Raves week 5_paulRaves week 5_paul
Raves week 5_paul
Deleuze78458 views
Lecture 1: The Rise of Modernism, 1800-1917 von Geoffrey Krawczyk
Lecture 1: The Rise of Modernism, 1800-1917Lecture 1: The Rise of Modernism, 1800-1917
Lecture 1: The Rise of Modernism, 1800-1917
Geoffrey Krawczyk697 views
Lecture notes week_3 von stephcas94
Lecture notes week_3Lecture notes week_3
Lecture notes week_3
stephcas945K views
Lecture 6A- Revolutions von LACCD
Lecture 6A- RevolutionsLecture 6A- Revolutions
Lecture 6A- Revolutions
LACCD1.5K views
Modernity lecture 2 2011 von mdyason
Modernity lecture 2 2011Modernity lecture 2 2011
Modernity lecture 2 2011
mdyason2.1K views
Modernism lesson 1 von sandraoddy2
Modernism lesson 1Modernism lesson 1
Modernism lesson 1
sandraoddy22.5K views

Similar a Soc 451, 4th class

CLASH_OF_CIVILIZATIONS 2.ppt von
CLASH_OF_CIVILIZATIONS 2.pptCLASH_OF_CIVILIZATIONS 2.ppt
CLASH_OF_CIVILIZATIONS 2.pptFarahElgendy
15 views25 Folien
The Contemporary World: Globalization of World Politics von
The Contemporary World: Globalization of World PoliticsThe Contemporary World: Globalization of World Politics
The Contemporary World: Globalization of World PoliticsRommel Regala
72.1K views247 Folien
Globalization of World Politics: An Introduction to International Relations von
Globalization of World Politics: An Introduction to International RelationsGlobalization of World Politics: An Introduction to International Relations
Globalization of World Politics: An Introduction to International RelationsRommel Regala
4.1K views248 Folien
International relations...intro 1 von
International relations...intro 1International relations...intro 1
International relations...intro 1hadaitullah
2.9K views61 Folien
ferneeamericancivilwar.pdf von
ferneeamericancivilwar.pdfferneeamericancivilwar.pdf
ferneeamericancivilwar.pdfKanikaBansal52
67 views18 Folien
Intro to IR von
Intro to IRIntro to IR
Intro to IRuniversity student
412 views25 Folien

Similar a Soc 451, 4th class(20)

CLASH_OF_CIVILIZATIONS 2.ppt von FarahElgendy
CLASH_OF_CIVILIZATIONS 2.pptCLASH_OF_CIVILIZATIONS 2.ppt
CLASH_OF_CIVILIZATIONS 2.ppt
FarahElgendy15 views
The Contemporary World: Globalization of World Politics von Rommel Regala
The Contemporary World: Globalization of World PoliticsThe Contemporary World: Globalization of World Politics
The Contemporary World: Globalization of World Politics
Rommel Regala72.1K views
Globalization of World Politics: An Introduction to International Relations von Rommel Regala
Globalization of World Politics: An Introduction to International RelationsGlobalization of World Politics: An Introduction to International Relations
Globalization of World Politics: An Introduction to International Relations
Rommel Regala4.1K views
International relations...intro 1 von hadaitullah
International relations...intro 1International relations...intro 1
International relations...intro 1
hadaitullah2.9K views
Political Science 7 – International Relations - Power Point #7 von John Paul Tabakian
Political Science 7 – International Relations - Power Point #7Political Science 7 – International Relations - Power Point #7
Political Science 7 – International Relations - Power Point #7
explaining Conflict and its types.pptx von sadafraja10
explaining Conflict and its types.pptxexplaining Conflict and its types.pptx
explaining Conflict and its types.pptx
sadafraja1052 views
Global Trend PPT week 1&2-converted.pdf von Damena Goda
Global Trend PPT week 1&2-converted.pdfGlobal Trend PPT week 1&2-converted.pdf
Global Trend PPT week 1&2-converted.pdf
Damena Goda3.2K views
Globalisation and the study of society von fatima d
Globalisation and the study of societyGlobalisation and the study of society
Globalisation and the study of society
fatima d5.3K views
The nuclear age and cold war von francoisenslin
The nuclear age and cold warThe nuclear age and cold war
The nuclear age and cold war
francoisenslin4.8K views
Global Media cultures von erickajoy4
Global Media culturesGlobal Media cultures
Global Media cultures
erickajoy4857 views
Stereotypes Of Nationalism And Racism von Jessica Tanner
Stereotypes Of Nationalism And RacismStereotypes Of Nationalism And Racism
Stereotypes Of Nationalism And Racism
Jessica Tanner2 views
Cp Snow The Two Cultures Analysis von Amber Voisine
Cp Snow The Two Cultures AnalysisCp Snow The Two Cultures Analysis
Cp Snow The Two Cultures Analysis
Amber Voisine13 views

Último

Scope of Biochemistry.pptx von
Scope of Biochemistry.pptxScope of Biochemistry.pptx
Scope of Biochemistry.pptxshoba shoba
133 views55 Folien
Ch. 7 Political Participation and Elections.pptx von
Ch. 7 Political Participation and Elections.pptxCh. 7 Political Participation and Elections.pptx
Ch. 7 Political Participation and Elections.pptxRommel Regala
97 views11 Folien
The Accursed House by Émile Gaboriau von
The Accursed House  by Émile GaboriauThe Accursed House  by Émile Gaboriau
The Accursed House by Émile GaboriauDivyaSheta
201 views15 Folien
The basics - information, data, technology and systems.pdf von
The basics - information, data, technology and systems.pdfThe basics - information, data, technology and systems.pdf
The basics - information, data, technology and systems.pdfJonathanCovena1
115 views1 Folie
Dance KS5 Breakdown von
Dance KS5 BreakdownDance KS5 Breakdown
Dance KS5 BreakdownWestHatch
79 views2 Folien
Narration ppt.pptx von
Narration  ppt.pptxNarration  ppt.pptx
Narration ppt.pptxTARIQ KHAN
135 views24 Folien

Último(20)

Scope of Biochemistry.pptx von shoba shoba
Scope of Biochemistry.pptxScope of Biochemistry.pptx
Scope of Biochemistry.pptx
shoba shoba133 views
Ch. 7 Political Participation and Elections.pptx von Rommel Regala
Ch. 7 Political Participation and Elections.pptxCh. 7 Political Participation and Elections.pptx
Ch. 7 Political Participation and Elections.pptx
Rommel Regala97 views
The Accursed House by Émile Gaboriau von DivyaSheta
The Accursed House  by Émile GaboriauThe Accursed House  by Émile Gaboriau
The Accursed House by Émile Gaboriau
DivyaSheta201 views
The basics - information, data, technology and systems.pdf von JonathanCovena1
The basics - information, data, technology and systems.pdfThe basics - information, data, technology and systems.pdf
The basics - information, data, technology and systems.pdf
JonathanCovena1115 views
Dance KS5 Breakdown von WestHatch
Dance KS5 BreakdownDance KS5 Breakdown
Dance KS5 Breakdown
WestHatch79 views
Narration ppt.pptx von TARIQ KHAN
Narration  ppt.pptxNarration  ppt.pptx
Narration ppt.pptx
TARIQ KHAN135 views
Narration lesson plan.docx von TARIQ KHAN
Narration lesson plan.docxNarration lesson plan.docx
Narration lesson plan.docx
TARIQ KHAN112 views
PLASMA PROTEIN (2).pptx von MEGHANA C
PLASMA PROTEIN (2).pptxPLASMA PROTEIN (2).pptx
PLASMA PROTEIN (2).pptx
MEGHANA C68 views
Education and Diversity.pptx von DrHafizKosar
Education and Diversity.pptxEducation and Diversity.pptx
Education and Diversity.pptx
DrHafizKosar173 views
Use of Probiotics in Aquaculture.pptx von AKSHAY MANDAL
Use of Probiotics in Aquaculture.pptxUse of Probiotics in Aquaculture.pptx
Use of Probiotics in Aquaculture.pptx
AKSHAY MANDAL100 views
REPRESENTATION - GAUNTLET.pptx von iammrhaywood
REPRESENTATION - GAUNTLET.pptxREPRESENTATION - GAUNTLET.pptx
REPRESENTATION - GAUNTLET.pptx
iammrhaywood100 views
Are we onboard yet University of Sussex.pptx von Jisc
Are we onboard yet University of Sussex.pptxAre we onboard yet University of Sussex.pptx
Are we onboard yet University of Sussex.pptx
Jisc96 views
Class 10 English notes 23-24.pptx von TARIQ KHAN
Class 10 English notes 23-24.pptxClass 10 English notes 23-24.pptx
Class 10 English notes 23-24.pptx
TARIQ KHAN131 views
The Open Access Community Framework (OACF) 2023 (1).pptx von Jisc
The Open Access Community Framework (OACF) 2023 (1).pptxThe Open Access Community Framework (OACF) 2023 (1).pptx
The Open Access Community Framework (OACF) 2023 (1).pptx
Jisc110 views
Drama KS5 Breakdown von WestHatch
Drama KS5 BreakdownDrama KS5 Breakdown
Drama KS5 Breakdown
WestHatch79 views
Structure and Functions of Cell.pdf von Nithya Murugan
Structure and Functions of Cell.pdfStructure and Functions of Cell.pdf
Structure and Functions of Cell.pdf
Nithya Murugan545 views

Soc 451, 4th class

  • 1. SOC 451 Globalization of Culture and Communication Global Political Structures and Processes Asst. Prof. Fatma Altınbaş Sarıgül
  • 2. Understanding of Contemporary Globalization • The global flow of people- refugees, illegal immigrants • Dwindling oil and water supply • Economic flows dominated by MNCs. • Economic and financial crisis • Environmental problems-Global warming • Diseases- Malaria, AIDS, etc. • War • Global Inequalities • Terrorism
  • 3. THE NATION-STATE • The Treaty of Westphalia (1648) ended the Thirty and Eighty Years Wars in Europe and instituted an international system which recognized sovereign states as its core. Nation: Social group linked through common descent, culture, language or territorial contiguity. (Cerny 2007:854) National Identity:A fluid and dynamic form of collective identity; members of the community believe that they are different from other groups. Nationalism: Doctrine and political movement that seek to make the nation the basis of a political structure. State: The new institutional form after the fuedal systemi offers a more centralized form of control. Nation-state: Integrates sub-groups that define themselves as a nation with the organizational structure that constituted the states
  • 4. Threats to the Nation-States • The global economy and global economic flows • Flows of information • Illegal immigrants • New Social Movements • Terrorists • Money and Drug Traffic • The growing power of global and transnational organizations • The growth of global problems • Growing interest in international human rights
  • 5. International Human Rights • The Declaration of International Human Rights states that human rights take precedence over the nation-state and that the UN is seeking control over the state on these issues. • The International Criminal Court (ICC) in 2002, created a venue in which those accused of human rights abuses could be tried and found guilty.
  • 6. THE NATION-STATE • It is still the major player on the global stage, but it retains some power in the face of globalization. • Some scholars argue that the issues which may be seen as threats to nation-states are also the issues which increase the power of the nation-states.
  • 7. IMMAGINED COMMUNITY (Benedict Anderson) • Nation-state is not a ‘natural’ phenomenon but is rather a social an political construction. • Anderson’s theory of ‘Immagined Community’ states that a nation primarily exists within the realm of ideas. • The idea of nation and nationalism is linked to two developments- the modern novel and the modern newspaper. • It was the mass sale and distribution of novels and newspapers that was critical to the rise of the imagined nation.
  • 8. Changes in Global Nation-State Relations • International Relations during WWII; The Allies ( US, Great Britain, France, Russia) The Axis (Germany, Japan, Italy) • During the Cold War; Soviet Bloc countries and West • Contemporary Question: How about international relations of the new global political world?
  • 9. Changes in Global Nation-State Relations • New Big Three in the World: The EU, China and the US. • Why EU is important? • Why China is important? • What about Russia? • Second World nations on the way; Turkey, Kazakhstan, Venezuela, Brazil, Saudi Arabia, Iran, Malaysia, Thailand.
  • 10. Global Political Institutions • League of Nations • United Nations (UN) • United Nations Conference on Trade and Development (UNCTAD) • United Nations Educational, Scientific and Cultural Organization (UNESCO) • International Atomic Energy Agency (IAEA) • G8 Nations- France, Germany, Italy, Japan, United Kingdom, US, Russia, Canada.