SlideShare a Scribd company logo
1 of 1
Study of psymberin’s mode of action using forward genetics
Vincent Tsao, Cheng-Yang Wu, and Dr. Michael Roth*
UT Southwestern Medical Center, Biochemistry Department, Dallas, TX
Background
Psmyberin is a member of the pederin family and inhibits translation in
vivo and in vitro. However, the inhibition by psymberin is 40 to 100
fold more effective than cycloheximide, a well-known translational
inhibitor. Looking at the half maximum values of translation inibition
and cytotoxicity of psymberin and cycloheximide reveal that
translation inhibition may not be the only method by which psymberin
induces cell death. In cycloheximide, the these values are very similar.
However, psymberin’s half maximum concentration of translation is
almost 20 times greater than it’s concentration of cytotoxicity.
Furthermore, in 8 hours where cells were treated by both psymberin
and cycloheximide separately, there are more cells detached from the
plate with psymberin treatment. This suggests that the two processes
are uncoupled.
Abstract
Psymberin, also known as Irciniastatin A, is an extremely potent
cytotoxin found in marine sponges Psammocinia and Ircinia ramose1
.
Many cancer cell lines, including breast cancer, melanoma, and colon
cancer are very sensitive to psymberin2
. Like other members of the
natural product family pederin, psymberin acts as an inhibitor of
protein synthesis. However, previous studies suggest that psymberin
may have additional bioactivity to induce cell death. These studies
suggest that psymberin might be a good candidate for cancer therapy
because it disturbs multiple cell pathways. In order to understand the
mode of activity of psymberin in cells, we use forward genetics in C
elegans. In our lab, 3 psymberin-resistant mutants were generated by
EMS mutagenesis and selected with psymberin treatment. Using
single nucleotide polymorphism mapping to locate the mutation, we
have found the mutation of a psymberin-resistant mutant to be on
chromosome II. We have mapped the mutation to be in the region
between +3.1 cM and +3.5 cM of chromosome II, and sequenced the
mutant gene, rpl-413
.
Hypothesis/Aim
Psymberin may induce cell death by pathways other than translation
inhibition. Our goal is to find the mode of action of psymberin in cells.
Future Directions
Acknowledgements
I would like to thank Dr. Nancy Street, Ms. Vanessa Powell, and all of
the people associated with the SURF program for giving me the
amazing opportunity to work and learn on the UT-Southwestern
campus. I would also to thank Dr. Michael Roth, Cheng-Yang Wu, and
the rest of the lab for welcoming me into the lab, assisting me in my
research, and making my experience rich and rewarding.
Strategy/Tool
• Forward genetics screening in C elegans to select drug-resistant
mutants.
• Single Nucleotide Polymorphism Mapping in semi-dominant
psymberin-resistant mutants (SNP mapping):
Summary
Wildtype: G Q T KG Q T K PP I F R KI F R K
GGA CAA ACC AAG CCA ATC TTC AGA AAG
16: G Q T KG Q T K LL I F R KI F R K
GGA CAA ACC AAG TCA ATC TTC AGA AAG
RPL-41 homologues:
C elegans RPL41 MVNVPKARRTFCDGKCRKHTNHKVTQYKKGKESKFAQGRRRYDRKQSGFGGQTKPIFRKK
Drosophila RPL36a MVNVPKARRTFCDGKCRKHTNHKVTQYKKGKESKFAQGRRRYDRKQSGFGGQTKPIFRKK
Human RPL36a MVNVPKTRRTFCK-KCGKHQPHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKK
Human RPL36al MVNVPKTRRTFCK-KCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKK
Mouse RPL36a MVNVPKTRRTFCK-KCGKHQPHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKK
C elegans RPL41 AKTTKKIVLRMECTE--CKHKKQLPIKRCKHFELGGQKKSRGQVIQF
Drosophila RPL36a AKTTKKIVLRMECTE--CKHKKQLPIKRCKHFELGGQKKSRGQVIQF
Human RPL36a AKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF
Human RPL36al AKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF
Mouse RPL36a AKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF
Through SNP mapping, we were able to narrow down the
region of the mutation in a pysmberin-resistant mutant 16 to
be between +3.1 cM and +3.5 cM on chromosome II. We
were able to pinpoint the mutation in the rpl-41 gene. The
mutation is a C to T mutation, which changes the amino acid
sequence by substituting proline with luecine. The effect of
this change will be further studied. rpl36a, which is the
human homologue of the rpl-41 gene in C elegans, encodes
105 amino acids and is a member of the RPL44E family.
The gene encodes a ribosomal protein that is a 60S
ribosome large subunit. RPL36a is also up-regulated in
different cancer cell lines. Overexpression of RPL36a in
hepatocellular carcinoma correlates to cell proliferation4
. The
location of RPL36a in ribosome is distant from peptide chain
synthesis core. These observations suggest RPL36a is a
potential cancer therapeutic target.
Figure 2. Results of gel electrophoresis after
digestion by the restriction endonuclease Apo1 for
samples 17,19,20,21,25-42,N2, and CB. Apo1 recognizes
the 6-base sequence 5’RAATTY’3 and cleaves after the first base
pair between bases R and A. This sequence is found in the N2
strain while altered by a SNP in the CB strain. Thus, a double band
would signify heterozygous chromosomes, a higher single band
would represent uncut homozygous CB chromosomes, and a lower
band would indicate homozygous N2 chromosomes.
+6.75
Seg 13 Seg 13 Seg 14 Seg 15 Seg 15 Seg 16 Seg 16 Seg 16 Seg 17
ChrII +1.38 +1.77 +3.1 +3.35 +3.5 +4.04 +4.11 +5.9 +6.75
loc cM cM cM cM cM cM cM cM cM
6 H H H N2 N2
62 H H H N2 N2
77 H H N2 N2 N2
96 H H H N2 N2
105 H H H N2 N2
N2
1 N2 N2 N2 CB
2 N2 H H H H H
6 N2 H H CB
7 N2 N2 CB CB CB CB
16 N2 N2 N2 CB CB CB
Figure 3. Sequencing data for samples 6, 58, 62, 77,
105, N2. The SNP site is indicated above. Each nucleotide (A,C,G,T)
is represented by a specific color and curve in the data. Samples 58,77,
and N2 exhibit the nucleotide C at the SNP site which corresponds to
the N2 wild type sequence. However, samples 6,62, and 105 exhibit
heterozygous chromosomes due to the presence of two curves and a
non-specific nucleotide listing.
Table I. Data from sequencing and digestion organized as
being homozygous N2, homozygous CB, or heterozygous
(H) at various positions along Chr II. The data from Figure 2
corresponds to the data listed for samples 6,62,77,96, and 105 on the table
at +3.1 cM. Data for samples 1,2,6,7, and 16 at +3.35 were collected in the
same procedure. Data for the samples at various other locations along ChrII
were collected via digestion (Figure 1) or sequencing (Figure 2).
Figure 4. Sequencing data for the point mutation in the rpl-41
gene. The mutation site is indicated above. The correct sequence for the rpl-
41 gene is also highlighted. The wild type nucleotide for rpl-41 is C, but these
samples have a T at this position. This mutation in the rpl-41 sequence for the
16 mutant could correspond to a change in the amino acid sequence.
Figure 5. Amino acid change from the point mutation in the rpl-
41 gene. In wild type C elegans, the amino acid produced from the ‘CCA’
sequence is proline. However, in the 16 mutant, the C to T mutation produces
leucine.
Figure 7. RPL-41 homologues including C elegans, Drosophila, Humans, and Mice. The amino acids are
highly conserved throughout these organisms. The sequences in blue show conserved residues. The mutation site (red) is in the
conserved region.
• Complement experiments in worm and human cells
• Explore how RPL36a affects ribosomes assembly and
translation.
• Explore how RPL36a contributes to psymberin-induced cell
death.
Figure 8. The structure of the RPL36a gene and the location in
60S ribosome. The structure of RPL36a is in green. The structure of 60S
ribosome is in gray. The location of the mutation in RPL36a is in yellow.
O
N
H
OMe
OH
OOMeMe
Me
OHO
O
HO
OH
Me
OH
Me
Me
4 8
Figure 1. The structure of the translational inhibitor
psymberin. The addition of the dihydroisocoumarin side
chain to the structure may contribute a secondary
bioactivity in psymberin to induce cell death.
N2 CB
References
1. Cichewicz, R.H., Valeriote, F.A., Crews, P. (2004). Org Lett. 6, 1951.
2. Jiang, X., Williams, N., De Brabander, J. K. (2007). Org Lett. 9, 227.
3. Wu, C.-Y., Cardenas, E. R. and Roth, M. G. unpublished result.
4. a. Kim, J.-H. et al. (2004). Hepatology,39(1). b. Hoebeke, I. et al. (2007). Lukemia, 21,
311. c. Uechi. T. et al. (2002). Nuc. Aci. Res. 30(24), 5369. d. Amsterdam, A. et al.
(2004). PLoS Bio., 2(5), 690.
5. Chandramouli et al. 2008. Structure,16(4), 535.

More Related Content

What's hot

journal.pone.0126088.PDF
journal.pone.0126088.PDFjournal.pone.0126088.PDF
journal.pone.0126088.PDFStuart Teal
 
Horrix et al. - 2010
Horrix et al. - 2010Horrix et al. - 2010
Horrix et al. - 2010Cristina Voss
 
Thant Bio Symposium Poster Spring 2016
Thant Bio Symposium Poster Spring 2016Thant Bio Symposium Poster Spring 2016
Thant Bio Symposium Poster Spring 2016Claire Thant
 
POLYCOMB GROUP OF PROTEINS
POLYCOMB GROUP OF PROTEINSPOLYCOMB GROUP OF PROTEINS
POLYCOMB GROUP OF PROTEINSRitasree Sarma
 
Honors Thesis Poster 2014
Honors Thesis Poster 2014Honors Thesis Poster 2014
Honors Thesis Poster 2014Connor Ratycz
 
.......More questions
.......More questions.......More questions
.......More questionsfkljsadkjlfa
 
Efficient transformation of lactococcus lactis il1403 and generation of knock...
Efficient transformation of lactococcus lactis il1403 and generation of knock...Efficient transformation of lactococcus lactis il1403 and generation of knock...
Efficient transformation of lactococcus lactis il1403 and generation of knock...CAS0609
 
A new effector pathway links ATM kinase with the DNA damage response
A new effector pathway links ATM kinase with the DNA damage responseA new effector pathway links ATM kinase with the DNA damage response
A new effector pathway links ATM kinase with the DNA damage responseCostas Demonacos
 
Safi et al.ng.2743
Safi et al.ng.2743Safi et al.ng.2743
Safi et al.ng.2743Hassan Safi
 
Mol. Biol. Cell-2015-Ayache-2579-95
Mol. Biol. Cell-2015-Ayache-2579-95Mol. Biol. Cell-2015-Ayache-2579-95
Mol. Biol. Cell-2015-Ayache-2579-95Jessica Ayache
 
Bacteria Induced Cryptic Meroterpenoid Pathway in Pathogenic Aspergillus fumi...
Bacteria Induced Cryptic Meroterpenoid Pathway in Pathogenic Aspergillus fumi...Bacteria Induced Cryptic Meroterpenoid Pathway in Pathogenic Aspergillus fumi...
Bacteria Induced Cryptic Meroterpenoid Pathway in Pathogenic Aspergillus fumi...Debanjan Chatterjee
 
A high copy number screen of the trs23Δ99C mutant
A high copy number screen of the trs23Δ99C mutantA high copy number screen of the trs23Δ99C mutant
A high copy number screen of the trs23Δ99C mutantGabriel Bendavit
 
Pol alpha phosphorylation NAR 00021-0119 (dragged)
Pol alpha phosphorylation NAR 00021-0119 (dragged)Pol alpha phosphorylation NAR 00021-0119 (dragged)
Pol alpha phosphorylation NAR 00021-0119 (dragged)Hyunsun Park
 

What's hot (20)

journal.pone.0126088.PDF
journal.pone.0126088.PDFjournal.pone.0126088.PDF
journal.pone.0126088.PDF
 
Horrix et al. - 2010
Horrix et al. - 2010Horrix et al. - 2010
Horrix et al. - 2010
 
finalposterapril13
finalposterapril13finalposterapril13
finalposterapril13
 
Thant Bio Symposium Poster Spring 2016
Thant Bio Symposium Poster Spring 2016Thant Bio Symposium Poster Spring 2016
Thant Bio Symposium Poster Spring 2016
 
POLYCOMB GROUP OF PROTEINS
POLYCOMB GROUP OF PROTEINSPOLYCOMB GROUP OF PROTEINS
POLYCOMB GROUP OF PROTEINS
 
SW_2016_Snehal
SW_2016_SnehalSW_2016_Snehal
SW_2016_Snehal
 
Honors Thesis Poster 2014
Honors Thesis Poster 2014Honors Thesis Poster 2014
Honors Thesis Poster 2014
 
UROP Poster
UROP PosterUROP Poster
UROP Poster
 
.......More questions
.......More questions.......More questions
.......More questions
 
CMBDictyPaper
CMBDictyPaperCMBDictyPaper
CMBDictyPaper
 
2013_WCBSURC.pptx
2013_WCBSURC.pptx2013_WCBSURC.pptx
2013_WCBSURC.pptx
 
Efficient transformation of lactococcus lactis il1403 and generation of knock...
Efficient transformation of lactococcus lactis il1403 and generation of knock...Efficient transformation of lactococcus lactis il1403 and generation of knock...
Efficient transformation of lactococcus lactis il1403 and generation of knock...
 
A new effector pathway links ATM kinase with the DNA damage response
A new effector pathway links ATM kinase with the DNA damage responseA new effector pathway links ATM kinase with the DNA damage response
A new effector pathway links ATM kinase with the DNA damage response
 
Safi et al.ng.2743
Safi et al.ng.2743Safi et al.ng.2743
Safi et al.ng.2743
 
EcoR124I_PR
EcoR124I_PREcoR124I_PR
EcoR124I_PR
 
Mol. Biol. Cell-2015-Ayache-2579-95
Mol. Biol. Cell-2015-Ayache-2579-95Mol. Biol. Cell-2015-Ayache-2579-95
Mol. Biol. Cell-2015-Ayache-2579-95
 
Bacteria Induced Cryptic Meroterpenoid Pathway in Pathogenic Aspergillus fumi...
Bacteria Induced Cryptic Meroterpenoid Pathway in Pathogenic Aspergillus fumi...Bacteria Induced Cryptic Meroterpenoid Pathway in Pathogenic Aspergillus fumi...
Bacteria Induced Cryptic Meroterpenoid Pathway in Pathogenic Aspergillus fumi...
 
review
reviewreview
review
 
A high copy number screen of the trs23Δ99C mutant
A high copy number screen of the trs23Δ99C mutantA high copy number screen of the trs23Δ99C mutant
A high copy number screen of the trs23Δ99C mutant
 
Pol alpha phosphorylation NAR 00021-0119 (dragged)
Pol alpha phosphorylation NAR 00021-0119 (dragged)Pol alpha phosphorylation NAR 00021-0119 (dragged)
Pol alpha phosphorylation NAR 00021-0119 (dragged)
 

Viewers also liked

Forward-looking Research: The Potential of New Genetic Technologies
Forward-looking Research:  The Potential of New Genetic TechnologiesForward-looking Research:  The Potential of New Genetic Technologies
Forward-looking Research: The Potential of New Genetic TechnologiesNorrie Disease Association
 
Genetic Manipulation Of The Mouse
Genetic Manipulation Of The MouseGenetic Manipulation Of The Mouse
Genetic Manipulation Of The MouseFraz Ismat
 
General Assembly 6-hour UX Design Hackathon
General Assembly 6-hour UX Design Hackathon General Assembly 6-hour UX Design Hackathon
General Assembly 6-hour UX Design Hackathon Vincent Tsao
 
Feature Selection in Machine Learning
Feature Selection in Machine LearningFeature Selection in Machine Learning
Feature Selection in Machine LearningUpekha Vandebona
 
2015. Bradley j. Till. Forward and reverse genetics for functional genomics a...
2015. Bradley j. Till. Forward and reverse genetics for functional genomics a...2015. Bradley j. Till. Forward and reverse genetics for functional genomics a...
2015. Bradley j. Till. Forward and reverse genetics for functional genomics a...FOODCROPS
 
Two dimensional gel electrophoresis
Two dimensional gel electrophoresisTwo dimensional gel electrophoresis
Two dimensional gel electrophoresisShyam K Uthaman
 
Forward and reverse genetics
Forward and reverse geneticsForward and reverse genetics
Forward and reverse geneticsSachin Ekatpure
 
Genetic Engineering and Biotechnology
Genetic Engineering and BiotechnologyGenetic Engineering and Biotechnology
Genetic Engineering and BiotechnologyStephen Taylor
 
Genetic algorithm
Genetic algorithmGenetic algorithm
Genetic algorithmgarima931
 

Viewers also liked (12)

Forward-looking Research: The Potential of New Genetic Technologies
Forward-looking Research:  The Potential of New Genetic TechnologiesForward-looking Research:  The Potential of New Genetic Technologies
Forward-looking Research: The Potential of New Genetic Technologies
 
Genetic Manipulation Of The Mouse
Genetic Manipulation Of The MouseGenetic Manipulation Of The Mouse
Genetic Manipulation Of The Mouse
 
General Assembly 6-hour UX Design Hackathon
General Assembly 6-hour UX Design Hackathon General Assembly 6-hour UX Design Hackathon
General Assembly 6-hour UX Design Hackathon
 
Feature Selection in Machine Learning
Feature Selection in Machine LearningFeature Selection in Machine Learning
Feature Selection in Machine Learning
 
2015. Bradley j. Till. Forward and reverse genetics for functional genomics a...
2015. Bradley j. Till. Forward and reverse genetics for functional genomics a...2015. Bradley j. Till. Forward and reverse genetics for functional genomics a...
2015. Bradley j. Till. Forward and reverse genetics for functional genomics a...
 
Reverse genetics
Reverse geneticsReverse genetics
Reverse genetics
 
Genetics appt
Genetics apptGenetics appt
Genetics appt
 
Mouse model: Pros & Cons
Mouse model: Pros & ConsMouse model: Pros & Cons
Mouse model: Pros & Cons
 
Two dimensional gel electrophoresis
Two dimensional gel electrophoresisTwo dimensional gel electrophoresis
Two dimensional gel electrophoresis
 
Forward and reverse genetics
Forward and reverse geneticsForward and reverse genetics
Forward and reverse genetics
 
Genetic Engineering and Biotechnology
Genetic Engineering and BiotechnologyGenetic Engineering and Biotechnology
Genetic Engineering and Biotechnology
 
Genetic algorithm
Genetic algorithmGenetic algorithm
Genetic algorithm
 

Similar to Study of psymberin's mode of action using forward genetics

The Role Of Mir 125A And Mir 223
The Role Of Mir 125A And Mir 223The Role Of Mir 125A And Mir 223
The Role Of Mir 125A And Mir 223Jenny Richardson
 
Epigenetic role in plant
Epigenetic role in plant Epigenetic role in plant
Epigenetic role in plant harshdeep josan
 
Voss et al. - 2006 - Identification and characterization of riproximin,
Voss et al. - 2006 - Identification and characterization of riproximin,Voss et al. - 2006 - Identification and characterization of riproximin,
Voss et al. - 2006 - Identification and characterization of riproximin,Cristina Voss
 
Cellular botany
Cellular botanyCellular botany
Cellular botanyviveg22
 
Oncogenesis is due to uncontrolled cell growth
Oncogenesis is due to uncontrolled cell growthOncogenesis is due to uncontrolled cell growth
Oncogenesis is due to uncontrolled cell growthmaryamsarwar17
 
Activation of surrogate death receptor signalling triggers peroxynitrite depe...
Activation of surrogate death receptor signalling triggers peroxynitrite depe...Activation of surrogate death receptor signalling triggers peroxynitrite depe...
Activation of surrogate death receptor signalling triggers peroxynitrite depe...Saurabh Shekhar
 
Molecular_bilogy_lab_report_1
Molecular_bilogy_lab_report_1Molecular_bilogy_lab_report_1
Molecular_bilogy_lab_report_1Elijah Willie
 
Clinical diagnosis of chronic myeloid leukemia by real time polymerase chain ...
Clinical diagnosis of chronic myeloid leukemia by real time polymerase chain ...Clinical diagnosis of chronic myeloid leukemia by real time polymerase chain ...
Clinical diagnosis of chronic myeloid leukemia by real time polymerase chain ...Teboho Mooko
 
Genetic Dna And Bioinformatics ( Accession No. Xp Essay
Genetic Dna And Bioinformatics ( Accession No. Xp EssayGenetic Dna And Bioinformatics ( Accession No. Xp Essay
Genetic Dna And Bioinformatics ( Accession No. Xp EssayJessica Deakin
 
Insights into the tumor microenvironment and therapeutic T cell manufacture r...
Insights into the tumor microenvironment and therapeutic T cell manufacture r...Insights into the tumor microenvironment and therapeutic T cell manufacture r...
Insights into the tumor microenvironment and therapeutic T cell manufacture r...Thermo Fisher Scientific
 
Jattir Emerging Scholars Poster
Jattir Emerging Scholars PosterJattir Emerging Scholars Poster
Jattir Emerging Scholars PosterJattir Farve
 
Poster_RosanaLopez_SULI_Summer2011_aug8_final_2
Poster_RosanaLopez_SULI_Summer2011_aug8_final_2Poster_RosanaLopez_SULI_Summer2011_aug8_final_2
Poster_RosanaLopez_SULI_Summer2011_aug8_final_2Rosana Lopez
 
2014-11-17 Taylor Broad Poster FINAL
2014-11-17 Taylor Broad Poster FINAL2014-11-17 Taylor Broad Poster FINAL
2014-11-17 Taylor Broad Poster FINALMichael Cuoco
 
Western Blotting Of Camkii Β And T 287
Western Blotting Of Camkii Β And T 287Western Blotting Of Camkii Β And T 287
Western Blotting Of Camkii Β And T 287Beth Salazar
 
(第1章第2部分)Prok.regulation(trp operon).pdf
(第1章第2部分)Prok.regulation(trp operon).pdf(第1章第2部分)Prok.regulation(trp operon).pdf
(第1章第2部分)Prok.regulation(trp operon).pdfssuser13f50b1
 
Cupid Peptides presentation wjr
Cupid Peptides presentation wjrCupid Peptides presentation wjr
Cupid Peptides presentation wjrCupid Peptides
 

Similar to Study of psymberin's mode of action using forward genetics (20)

The Role Of Mir 125A And Mir 223
The Role Of Mir 125A And Mir 223The Role Of Mir 125A And Mir 223
The Role Of Mir 125A And Mir 223
 
Epigenetic role in plant
Epigenetic role in plant Epigenetic role in plant
Epigenetic role in plant
 
Lepow Day Poster
Lepow Day PosterLepow Day Poster
Lepow Day Poster
 
nature
naturenature
nature
 
Voss et al. - 2006 - Identification and characterization of riproximin,
Voss et al. - 2006 - Identification and characterization of riproximin,Voss et al. - 2006 - Identification and characterization of riproximin,
Voss et al. - 2006 - Identification and characterization of riproximin,
 
Cellular botany
Cellular botanyCellular botany
Cellular botany
 
Oncogenesis is due to uncontrolled cell growth
Oncogenesis is due to uncontrolled cell growthOncogenesis is due to uncontrolled cell growth
Oncogenesis is due to uncontrolled cell growth
 
Activation of surrogate death receptor signalling triggers peroxynitrite depe...
Activation of surrogate death receptor signalling triggers peroxynitrite depe...Activation of surrogate death receptor signalling triggers peroxynitrite depe...
Activation of surrogate death receptor signalling triggers peroxynitrite depe...
 
Molecular_bilogy_lab_report_1
Molecular_bilogy_lab_report_1Molecular_bilogy_lab_report_1
Molecular_bilogy_lab_report_1
 
Lepow Day Poster 2
Lepow Day Poster 2Lepow Day Poster 2
Lepow Day Poster 2
 
Clinical diagnosis of chronic myeloid leukemia by real time polymerase chain ...
Clinical diagnosis of chronic myeloid leukemia by real time polymerase chain ...Clinical diagnosis of chronic myeloid leukemia by real time polymerase chain ...
Clinical diagnosis of chronic myeloid leukemia by real time polymerase chain ...
 
Genetic Dna And Bioinformatics ( Accession No. Xp Essay
Genetic Dna And Bioinformatics ( Accession No. Xp EssayGenetic Dna And Bioinformatics ( Accession No. Xp Essay
Genetic Dna And Bioinformatics ( Accession No. Xp Essay
 
Insights into the tumor microenvironment and therapeutic T cell manufacture r...
Insights into the tumor microenvironment and therapeutic T cell manufacture r...Insights into the tumor microenvironment and therapeutic T cell manufacture r...
Insights into the tumor microenvironment and therapeutic T cell manufacture r...
 
Jattir Emerging Scholars Poster
Jattir Emerging Scholars PosterJattir Emerging Scholars Poster
Jattir Emerging Scholars Poster
 
Poster_RosanaLopez_SULI_Summer2011_aug8_final_2
Poster_RosanaLopez_SULI_Summer2011_aug8_final_2Poster_RosanaLopez_SULI_Summer2011_aug8_final_2
Poster_RosanaLopez_SULI_Summer2011_aug8_final_2
 
2014-11-17 Taylor Broad Poster FINAL
2014-11-17 Taylor Broad Poster FINAL2014-11-17 Taylor Broad Poster FINAL
2014-11-17 Taylor Broad Poster FINAL
 
MGG2003-cDNA-AFLP
MGG2003-cDNA-AFLPMGG2003-cDNA-AFLP
MGG2003-cDNA-AFLP
 
Western Blotting Of Camkii Β And T 287
Western Blotting Of Camkii Β And T 287Western Blotting Of Camkii Β And T 287
Western Blotting Of Camkii Β And T 287
 
(第1章第2部分)Prok.regulation(trp operon).pdf
(第1章第2部分)Prok.regulation(trp operon).pdf(第1章第2部分)Prok.regulation(trp operon).pdf
(第1章第2部分)Prok.regulation(trp operon).pdf
 
Cupid Peptides presentation wjr
Cupid Peptides presentation wjrCupid Peptides presentation wjr
Cupid Peptides presentation wjr
 

More from Vincent Tsao

Copywriting mistakes&fixes
Copywriting mistakes&fixesCopywriting mistakes&fixes
Copywriting mistakes&fixesVincent Tsao
 
McDonald's Indonesia
McDonald's IndonesiaMcDonald's Indonesia
McDonald's IndonesiaVincent Tsao
 
First Up Introduction
First Up IntroductionFirst Up Introduction
First Up IntroductionVincent Tsao
 
Effect of Education, Experience, and Media on USC Students’ Preferences for D...
Effect of Education, Experience, and Media on USC Students’ Preferences for D...Effect of Education, Experience, and Media on USC Students’ Preferences for D...
Effect of Education, Experience, and Media on USC Students’ Preferences for D...Vincent Tsao
 
Conecepts business plan
Conecepts business planConecepts business plan
Conecepts business planVincent Tsao
 
Jumpit Final Presentation
Jumpit Final Presentation Jumpit Final Presentation
Jumpit Final Presentation Vincent Tsao
 
MKT 470 Marketing Research- Toyota Yaris
MKT 470 Marketing Research- Toyota Yaris MKT 470 Marketing Research- Toyota Yaris
MKT 470 Marketing Research- Toyota Yaris Vincent Tsao
 
CNTV 467 Future of Digital Media- TV World
CNTV 467 Future of Digital Media- TV World CNTV 467 Future of Digital Media- TV World
CNTV 467 Future of Digital Media- TV World Vincent Tsao
 
BUAD 497 Strategic Management- Spotify
BUAD 497 Strategic Management- Spotify BUAD 497 Strategic Management- Spotify
BUAD 497 Strategic Management- Spotify Vincent Tsao
 
MOR 492 Global Strategy- Jamba Juice in China
MOR 492 Global Strategy- Jamba Juice in China MOR 492 Global Strategy- Jamba Juice in China
MOR 492 Global Strategy- Jamba Juice in China Vincent Tsao
 
Tsao, vincent visual merchandising internship
Tsao, vincent   visual merchandising internshipTsao, vincent   visual merchandising internship
Tsao, vincent visual merchandising internshipVincent Tsao
 
Steemy demo (LavaLab)
Steemy demo (LavaLab)Steemy demo (LavaLab)
Steemy demo (LavaLab)Vincent Tsao
 

More from Vincent Tsao (12)

Copywriting mistakes&fixes
Copywriting mistakes&fixesCopywriting mistakes&fixes
Copywriting mistakes&fixes
 
McDonald's Indonesia
McDonald's IndonesiaMcDonald's Indonesia
McDonald's Indonesia
 
First Up Introduction
First Up IntroductionFirst Up Introduction
First Up Introduction
 
Effect of Education, Experience, and Media on USC Students’ Preferences for D...
Effect of Education, Experience, and Media on USC Students’ Preferences for D...Effect of Education, Experience, and Media on USC Students’ Preferences for D...
Effect of Education, Experience, and Media on USC Students’ Preferences for D...
 
Conecepts business plan
Conecepts business planConecepts business plan
Conecepts business plan
 
Jumpit Final Presentation
Jumpit Final Presentation Jumpit Final Presentation
Jumpit Final Presentation
 
MKT 470 Marketing Research- Toyota Yaris
MKT 470 Marketing Research- Toyota Yaris MKT 470 Marketing Research- Toyota Yaris
MKT 470 Marketing Research- Toyota Yaris
 
CNTV 467 Future of Digital Media- TV World
CNTV 467 Future of Digital Media- TV World CNTV 467 Future of Digital Media- TV World
CNTV 467 Future of Digital Media- TV World
 
BUAD 497 Strategic Management- Spotify
BUAD 497 Strategic Management- Spotify BUAD 497 Strategic Management- Spotify
BUAD 497 Strategic Management- Spotify
 
MOR 492 Global Strategy- Jamba Juice in China
MOR 492 Global Strategy- Jamba Juice in China MOR 492 Global Strategy- Jamba Juice in China
MOR 492 Global Strategy- Jamba Juice in China
 
Tsao, vincent visual merchandising internship
Tsao, vincent   visual merchandising internshipTsao, vincent   visual merchandising internship
Tsao, vincent visual merchandising internship
 
Steemy demo (LavaLab)
Steemy demo (LavaLab)Steemy demo (LavaLab)
Steemy demo (LavaLab)
 

Recently uploaded

Asthma Review - GINA guidelines summary 2024
Asthma Review - GINA guidelines summary 2024Asthma Review - GINA guidelines summary 2024
Asthma Review - GINA guidelines summary 2024Gabriel Guevara MD
 
Aspirin presentation slides by Dr. Rewas Ali
Aspirin presentation slides by Dr. Rewas AliAspirin presentation slides by Dr. Rewas Ali
Aspirin presentation slides by Dr. Rewas AliRewAs ALI
 
VIP Call Girls Lucknow Nandini 7001305949 Independent Escort Service Lucknow
VIP Call Girls Lucknow Nandini 7001305949 Independent Escort Service LucknowVIP Call Girls Lucknow Nandini 7001305949 Independent Escort Service Lucknow
VIP Call Girls Lucknow Nandini 7001305949 Independent Escort Service Lucknownarwatsonia7
 
VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...
VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...
VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...Miss joya
 
VIP Call Girls Mumbai Arpita 9910780858 Independent Escort Service Mumbai
VIP Call Girls Mumbai Arpita 9910780858 Independent Escort Service MumbaiVIP Call Girls Mumbai Arpita 9910780858 Independent Escort Service Mumbai
VIP Call Girls Mumbai Arpita 9910780858 Independent Escort Service Mumbaisonalikaur4
 
Call Girls Thane Just Call 9910780858 Get High Class Call Girls Service
Call Girls Thane Just Call 9910780858 Get High Class Call Girls ServiceCall Girls Thane Just Call 9910780858 Get High Class Call Girls Service
Call Girls Thane Just Call 9910780858 Get High Class Call Girls Servicesonalikaur4
 
Housewife Call Girls Bangalore - Call 7001305949 Rs-3500 with A/C Room Cash o...
Housewife Call Girls Bangalore - Call 7001305949 Rs-3500 with A/C Room Cash o...Housewife Call Girls Bangalore - Call 7001305949 Rs-3500 with A/C Room Cash o...
Housewife Call Girls Bangalore - Call 7001305949 Rs-3500 with A/C Room Cash o...narwatsonia7
 
call girls in green park DELHI 🔝 >༒9540349809 🔝 genuine Escort Service 🔝✔️✔️
call girls in green park  DELHI 🔝 >༒9540349809 🔝 genuine Escort Service 🔝✔️✔️call girls in green park  DELHI 🔝 >༒9540349809 🔝 genuine Escort Service 🔝✔️✔️
call girls in green park DELHI 🔝 >༒9540349809 🔝 genuine Escort Service 🔝✔️✔️saminamagar
 
Low Rate Call Girls Mumbai Suman 9910780858 Independent Escort Service Mumbai
Low Rate Call Girls Mumbai Suman 9910780858 Independent Escort Service MumbaiLow Rate Call Girls Mumbai Suman 9910780858 Independent Escort Service Mumbai
Low Rate Call Girls Mumbai Suman 9910780858 Independent Escort Service Mumbaisonalikaur4
 
Call Girls Jp Nagar Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Jp Nagar Just Call 7001305949 Top Class Call Girl Service AvailableCall Girls Jp Nagar Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Jp Nagar Just Call 7001305949 Top Class Call Girl Service Availablenarwatsonia7
 
Book Call Girls in Yelahanka - For 7001305949 Cheap & Best with original Photos
Book Call Girls in Yelahanka - For 7001305949 Cheap & Best with original PhotosBook Call Girls in Yelahanka - For 7001305949 Cheap & Best with original Photos
Book Call Girls in Yelahanka - For 7001305949 Cheap & Best with original Photosnarwatsonia7
 
College Call Girls Pune Mira 9907093804 Short 1500 Night 6000 Best call girls...
College Call Girls Pune Mira 9907093804 Short 1500 Night 6000 Best call girls...College Call Girls Pune Mira 9907093804 Short 1500 Night 6000 Best call girls...
College Call Girls Pune Mira 9907093804 Short 1500 Night 6000 Best call girls...Miss joya
 
College Call Girls Vyasarpadi Whatsapp 7001305949 Independent Escort Service
College Call Girls Vyasarpadi Whatsapp 7001305949 Independent Escort ServiceCollege Call Girls Vyasarpadi Whatsapp 7001305949 Independent Escort Service
College Call Girls Vyasarpadi Whatsapp 7001305949 Independent Escort ServiceNehru place Escorts
 
Call Girls Service in Bommanahalli - 7001305949 with real photos and phone nu...
Call Girls Service in Bommanahalli - 7001305949 with real photos and phone nu...Call Girls Service in Bommanahalli - 7001305949 with real photos and phone nu...
Call Girls Service in Bommanahalli - 7001305949 with real photos and phone nu...narwatsonia7
 
Bangalore Call Girls Marathahalli 📞 9907093804 High Profile Service 100% Safe
Bangalore Call Girls Marathahalli 📞 9907093804 High Profile Service 100% SafeBangalore Call Girls Marathahalli 📞 9907093804 High Profile Service 100% Safe
Bangalore Call Girls Marathahalli 📞 9907093804 High Profile Service 100% Safenarwatsonia7
 
Mumbai Call Girls Service 9910780858 Real Russian Girls Looking Models
Mumbai Call Girls Service 9910780858 Real Russian Girls Looking ModelsMumbai Call Girls Service 9910780858 Real Russian Girls Looking Models
Mumbai Call Girls Service 9910780858 Real Russian Girls Looking Modelssonalikaur4
 
Call Girls Whitefield Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Whitefield Just Call 7001305949 Top Class Call Girl Service AvailableCall Girls Whitefield Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Whitefield Just Call 7001305949 Top Class Call Girl Service Availablenarwatsonia7
 
Call Girl Lucknow Mallika 7001305949 Independent Escort Service Lucknow
Call Girl Lucknow Mallika 7001305949 Independent Escort Service LucknowCall Girl Lucknow Mallika 7001305949 Independent Escort Service Lucknow
Call Girl Lucknow Mallika 7001305949 Independent Escort Service Lucknownarwatsonia7
 
Sonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call Now
Sonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call NowSonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call Now
Sonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call NowRiya Pathan
 

Recently uploaded (20)

Asthma Review - GINA guidelines summary 2024
Asthma Review - GINA guidelines summary 2024Asthma Review - GINA guidelines summary 2024
Asthma Review - GINA guidelines summary 2024
 
Aspirin presentation slides by Dr. Rewas Ali
Aspirin presentation slides by Dr. Rewas AliAspirin presentation slides by Dr. Rewas Ali
Aspirin presentation slides by Dr. Rewas Ali
 
VIP Call Girls Lucknow Nandini 7001305949 Independent Escort Service Lucknow
VIP Call Girls Lucknow Nandini 7001305949 Independent Escort Service LucknowVIP Call Girls Lucknow Nandini 7001305949 Independent Escort Service Lucknow
VIP Call Girls Lucknow Nandini 7001305949 Independent Escort Service Lucknow
 
VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...
VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...
VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...
 
VIP Call Girls Mumbai Arpita 9910780858 Independent Escort Service Mumbai
VIP Call Girls Mumbai Arpita 9910780858 Independent Escort Service MumbaiVIP Call Girls Mumbai Arpita 9910780858 Independent Escort Service Mumbai
VIP Call Girls Mumbai Arpita 9910780858 Independent Escort Service Mumbai
 
Call Girls Thane Just Call 9910780858 Get High Class Call Girls Service
Call Girls Thane Just Call 9910780858 Get High Class Call Girls ServiceCall Girls Thane Just Call 9910780858 Get High Class Call Girls Service
Call Girls Thane Just Call 9910780858 Get High Class Call Girls Service
 
Housewife Call Girls Bangalore - Call 7001305949 Rs-3500 with A/C Room Cash o...
Housewife Call Girls Bangalore - Call 7001305949 Rs-3500 with A/C Room Cash o...Housewife Call Girls Bangalore - Call 7001305949 Rs-3500 with A/C Room Cash o...
Housewife Call Girls Bangalore - Call 7001305949 Rs-3500 with A/C Room Cash o...
 
call girls in green park DELHI 🔝 >༒9540349809 🔝 genuine Escort Service 🔝✔️✔️
call girls in green park  DELHI 🔝 >༒9540349809 🔝 genuine Escort Service 🔝✔️✔️call girls in green park  DELHI 🔝 >༒9540349809 🔝 genuine Escort Service 🔝✔️✔️
call girls in green park DELHI 🔝 >༒9540349809 🔝 genuine Escort Service 🔝✔️✔️
 
Low Rate Call Girls Mumbai Suman 9910780858 Independent Escort Service Mumbai
Low Rate Call Girls Mumbai Suman 9910780858 Independent Escort Service MumbaiLow Rate Call Girls Mumbai Suman 9910780858 Independent Escort Service Mumbai
Low Rate Call Girls Mumbai Suman 9910780858 Independent Escort Service Mumbai
 
Call Girls Jp Nagar Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Jp Nagar Just Call 7001305949 Top Class Call Girl Service AvailableCall Girls Jp Nagar Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Jp Nagar Just Call 7001305949 Top Class Call Girl Service Available
 
Book Call Girls in Yelahanka - For 7001305949 Cheap & Best with original Photos
Book Call Girls in Yelahanka - For 7001305949 Cheap & Best with original PhotosBook Call Girls in Yelahanka - For 7001305949 Cheap & Best with original Photos
Book Call Girls in Yelahanka - For 7001305949 Cheap & Best with original Photos
 
College Call Girls Pune Mira 9907093804 Short 1500 Night 6000 Best call girls...
College Call Girls Pune Mira 9907093804 Short 1500 Night 6000 Best call girls...College Call Girls Pune Mira 9907093804 Short 1500 Night 6000 Best call girls...
College Call Girls Pune Mira 9907093804 Short 1500 Night 6000 Best call girls...
 
College Call Girls Vyasarpadi Whatsapp 7001305949 Independent Escort Service
College Call Girls Vyasarpadi Whatsapp 7001305949 Independent Escort ServiceCollege Call Girls Vyasarpadi Whatsapp 7001305949 Independent Escort Service
College Call Girls Vyasarpadi Whatsapp 7001305949 Independent Escort Service
 
Call Girls Service in Bommanahalli - 7001305949 with real photos and phone nu...
Call Girls Service in Bommanahalli - 7001305949 with real photos and phone nu...Call Girls Service in Bommanahalli - 7001305949 with real photos and phone nu...
Call Girls Service in Bommanahalli - 7001305949 with real photos and phone nu...
 
Bangalore Call Girls Marathahalli 📞 9907093804 High Profile Service 100% Safe
Bangalore Call Girls Marathahalli 📞 9907093804 High Profile Service 100% SafeBangalore Call Girls Marathahalli 📞 9907093804 High Profile Service 100% Safe
Bangalore Call Girls Marathahalli 📞 9907093804 High Profile Service 100% Safe
 
sauth delhi call girls in Bhajanpura 🔝 9953056974 🔝 escort Service
sauth delhi call girls in Bhajanpura 🔝 9953056974 🔝 escort Servicesauth delhi call girls in Bhajanpura 🔝 9953056974 🔝 escort Service
sauth delhi call girls in Bhajanpura 🔝 9953056974 🔝 escort Service
 
Mumbai Call Girls Service 9910780858 Real Russian Girls Looking Models
Mumbai Call Girls Service 9910780858 Real Russian Girls Looking ModelsMumbai Call Girls Service 9910780858 Real Russian Girls Looking Models
Mumbai Call Girls Service 9910780858 Real Russian Girls Looking Models
 
Call Girls Whitefield Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Whitefield Just Call 7001305949 Top Class Call Girl Service AvailableCall Girls Whitefield Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Whitefield Just Call 7001305949 Top Class Call Girl Service Available
 
Call Girl Lucknow Mallika 7001305949 Independent Escort Service Lucknow
Call Girl Lucknow Mallika 7001305949 Independent Escort Service LucknowCall Girl Lucknow Mallika 7001305949 Independent Escort Service Lucknow
Call Girl Lucknow Mallika 7001305949 Independent Escort Service Lucknow
 
Sonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call Now
Sonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call NowSonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call Now
Sonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call Now
 

Study of psymberin's mode of action using forward genetics

  • 1. Study of psymberin’s mode of action using forward genetics Vincent Tsao, Cheng-Yang Wu, and Dr. Michael Roth* UT Southwestern Medical Center, Biochemistry Department, Dallas, TX Background Psmyberin is a member of the pederin family and inhibits translation in vivo and in vitro. However, the inhibition by psymberin is 40 to 100 fold more effective than cycloheximide, a well-known translational inhibitor. Looking at the half maximum values of translation inibition and cytotoxicity of psymberin and cycloheximide reveal that translation inhibition may not be the only method by which psymberin induces cell death. In cycloheximide, the these values are very similar. However, psymberin’s half maximum concentration of translation is almost 20 times greater than it’s concentration of cytotoxicity. Furthermore, in 8 hours where cells were treated by both psymberin and cycloheximide separately, there are more cells detached from the plate with psymberin treatment. This suggests that the two processes are uncoupled. Abstract Psymberin, also known as Irciniastatin A, is an extremely potent cytotoxin found in marine sponges Psammocinia and Ircinia ramose1 . Many cancer cell lines, including breast cancer, melanoma, and colon cancer are very sensitive to psymberin2 . Like other members of the natural product family pederin, psymberin acts as an inhibitor of protein synthesis. However, previous studies suggest that psymberin may have additional bioactivity to induce cell death. These studies suggest that psymberin might be a good candidate for cancer therapy because it disturbs multiple cell pathways. In order to understand the mode of activity of psymberin in cells, we use forward genetics in C elegans. In our lab, 3 psymberin-resistant mutants were generated by EMS mutagenesis and selected with psymberin treatment. Using single nucleotide polymorphism mapping to locate the mutation, we have found the mutation of a psymberin-resistant mutant to be on chromosome II. We have mapped the mutation to be in the region between +3.1 cM and +3.5 cM of chromosome II, and sequenced the mutant gene, rpl-413 . Hypothesis/Aim Psymberin may induce cell death by pathways other than translation inhibition. Our goal is to find the mode of action of psymberin in cells. Future Directions Acknowledgements I would like to thank Dr. Nancy Street, Ms. Vanessa Powell, and all of the people associated with the SURF program for giving me the amazing opportunity to work and learn on the UT-Southwestern campus. I would also to thank Dr. Michael Roth, Cheng-Yang Wu, and the rest of the lab for welcoming me into the lab, assisting me in my research, and making my experience rich and rewarding. Strategy/Tool • Forward genetics screening in C elegans to select drug-resistant mutants. • Single Nucleotide Polymorphism Mapping in semi-dominant psymberin-resistant mutants (SNP mapping): Summary Wildtype: G Q T KG Q T K PP I F R KI F R K GGA CAA ACC AAG CCA ATC TTC AGA AAG 16: G Q T KG Q T K LL I F R KI F R K GGA CAA ACC AAG TCA ATC TTC AGA AAG RPL-41 homologues: C elegans RPL41 MVNVPKARRTFCDGKCRKHTNHKVTQYKKGKESKFAQGRRRYDRKQSGFGGQTKPIFRKK Drosophila RPL36a MVNVPKARRTFCDGKCRKHTNHKVTQYKKGKESKFAQGRRRYDRKQSGFGGQTKPIFRKK Human RPL36a MVNVPKTRRTFCK-KCGKHQPHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKK Human RPL36al MVNVPKTRRTFCK-KCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKK Mouse RPL36a MVNVPKTRRTFCK-KCGKHQPHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKK C elegans RPL41 AKTTKKIVLRMECTE--CKHKKQLPIKRCKHFELGGQKKSRGQVIQF Drosophila RPL36a AKTTKKIVLRMECTE--CKHKKQLPIKRCKHFELGGQKKSRGQVIQF Human RPL36a AKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF Human RPL36al AKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF Mouse RPL36a AKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF Through SNP mapping, we were able to narrow down the region of the mutation in a pysmberin-resistant mutant 16 to be between +3.1 cM and +3.5 cM on chromosome II. We were able to pinpoint the mutation in the rpl-41 gene. The mutation is a C to T mutation, which changes the amino acid sequence by substituting proline with luecine. The effect of this change will be further studied. rpl36a, which is the human homologue of the rpl-41 gene in C elegans, encodes 105 amino acids and is a member of the RPL44E family. The gene encodes a ribosomal protein that is a 60S ribosome large subunit. RPL36a is also up-regulated in different cancer cell lines. Overexpression of RPL36a in hepatocellular carcinoma correlates to cell proliferation4 . The location of RPL36a in ribosome is distant from peptide chain synthesis core. These observations suggest RPL36a is a potential cancer therapeutic target. Figure 2. Results of gel electrophoresis after digestion by the restriction endonuclease Apo1 for samples 17,19,20,21,25-42,N2, and CB. Apo1 recognizes the 6-base sequence 5’RAATTY’3 and cleaves after the first base pair between bases R and A. This sequence is found in the N2 strain while altered by a SNP in the CB strain. Thus, a double band would signify heterozygous chromosomes, a higher single band would represent uncut homozygous CB chromosomes, and a lower band would indicate homozygous N2 chromosomes. +6.75 Seg 13 Seg 13 Seg 14 Seg 15 Seg 15 Seg 16 Seg 16 Seg 16 Seg 17 ChrII +1.38 +1.77 +3.1 +3.35 +3.5 +4.04 +4.11 +5.9 +6.75 loc cM cM cM cM cM cM cM cM cM 6 H H H N2 N2 62 H H H N2 N2 77 H H N2 N2 N2 96 H H H N2 N2 105 H H H N2 N2 N2 1 N2 N2 N2 CB 2 N2 H H H H H 6 N2 H H CB 7 N2 N2 CB CB CB CB 16 N2 N2 N2 CB CB CB Figure 3. Sequencing data for samples 6, 58, 62, 77, 105, N2. The SNP site is indicated above. Each nucleotide (A,C,G,T) is represented by a specific color and curve in the data. Samples 58,77, and N2 exhibit the nucleotide C at the SNP site which corresponds to the N2 wild type sequence. However, samples 6,62, and 105 exhibit heterozygous chromosomes due to the presence of two curves and a non-specific nucleotide listing. Table I. Data from sequencing and digestion organized as being homozygous N2, homozygous CB, or heterozygous (H) at various positions along Chr II. The data from Figure 2 corresponds to the data listed for samples 6,62,77,96, and 105 on the table at +3.1 cM. Data for samples 1,2,6,7, and 16 at +3.35 were collected in the same procedure. Data for the samples at various other locations along ChrII were collected via digestion (Figure 1) or sequencing (Figure 2). Figure 4. Sequencing data for the point mutation in the rpl-41 gene. The mutation site is indicated above. The correct sequence for the rpl- 41 gene is also highlighted. The wild type nucleotide for rpl-41 is C, but these samples have a T at this position. This mutation in the rpl-41 sequence for the 16 mutant could correspond to a change in the amino acid sequence. Figure 5. Amino acid change from the point mutation in the rpl- 41 gene. In wild type C elegans, the amino acid produced from the ‘CCA’ sequence is proline. However, in the 16 mutant, the C to T mutation produces leucine. Figure 7. RPL-41 homologues including C elegans, Drosophila, Humans, and Mice. The amino acids are highly conserved throughout these organisms. The sequences in blue show conserved residues. The mutation site (red) is in the conserved region. • Complement experiments in worm and human cells • Explore how RPL36a affects ribosomes assembly and translation. • Explore how RPL36a contributes to psymberin-induced cell death. Figure 8. The structure of the RPL36a gene and the location in 60S ribosome. The structure of RPL36a is in green. The structure of 60S ribosome is in gray. The location of the mutation in RPL36a is in yellow. O N H OMe OH OOMeMe Me OHO O HO OH Me OH Me Me 4 8 Figure 1. The structure of the translational inhibitor psymberin. The addition of the dihydroisocoumarin side chain to the structure may contribute a secondary bioactivity in psymberin to induce cell death. N2 CB References 1. Cichewicz, R.H., Valeriote, F.A., Crews, P. (2004). Org Lett. 6, 1951. 2. Jiang, X., Williams, N., De Brabander, J. K. (2007). Org Lett. 9, 227. 3. Wu, C.-Y., Cardenas, E. R. and Roth, M. G. unpublished result. 4. a. Kim, J.-H. et al. (2004). Hepatology,39(1). b. Hoebeke, I. et al. (2007). Lukemia, 21, 311. c. Uechi. T. et al. (2002). Nuc. Aci. Res. 30(24), 5369. d. Amsterdam, A. et al. (2004). PLoS Bio., 2(5), 690. 5. Chandramouli et al. 2008. Structure,16(4), 535.