Diese Präsentation wurde erfolgreich gemeldet.
Wir verwenden Ihre LinkedIn Profilangaben und Informationen zu Ihren Aktivitäten, um Anzeigen zu personalisieren und Ihnen relevantere Inhalte anzuzeigen. Sie können Ihre Anzeigeneinstellungen jederzeit ändern.

Materi+pmbok ver+5

1.254 Aufrufe

Veröffentlicht am

Materi+pmbok ver+5

Veröffentlicht in: Business
  • Als Erste(r) kommentieren

Materi+pmbok ver+5

  1. 1. AWARENESS OF PROJECT MANAGEMENT (PMBOK © Guide 2013 Edition)
  2. 2. Project ???? Projectadalahusahaberbataswaktuyangdilakukanuntukmenghasilkansesuatuyangunik, produk,jasaatau hasil. – Temporary=berbataswaktu(kapanmulaidan berakhir) – Dapatberulangnamunmempunyaikeunikan mendasar – Dapatdiuraikansecara progresif. • Karakteristikyangmembedakansetiapproyekyangunik.Semakindapatdiuraikan secaraprogresif/ rinci,semakinlebihbaikdipahamisebagaisebuah proyek.
  3. 3. Project >< Operational Work Projects • Toattain its objectives and terminate • Create own character, organization, and goals • Catalyst for change • Unique product or services • Heterogeneous teams • Start and end date Operations • Tosustain the business • Semi permanent charter, organization, and goals • Maintain status quo • Standard product or services • Homogeneous teams • Ongoing Examples • Producing a News letter • Writing and publishing a book • Implementing a LAN • Hiring a sales man • Arrange for a conference • Opening for a new shop • Producing the annual report Examples • Responding to customers requests • Writing a letter to a Prospect • Hooking up a Printer to a computer • Meeting with an employee • Attending a conference • Opening the shop • Writing a progress update memo
  4. 4. Project Management ??? • Penerapanpengetahuan,ketrampilan,alat-alat danteknikdalamkegiatan proyekuntukmemenuhipersyaratan proyek • ManajemenProyekdapatdicapaimelaluipenerapandanintegrasidari prosesyangdikelompokkandalam5(lima)kelompokproses : 1. Initiating/ Inisiasi 2. Planning/ Perencanaan 3. Executing/ Eksekusi 4. MonitoringandControlling/ Pemantuan dan Pengendalian 5. Closing/ Penutupan • Dikarenakan adanya sifat perubahan, mengelola proyek secara berulang dan melalui elaborasi progresif sepanjang siklus hidup proyek (project’s lifecycle)
  5. 5. Managing Project • ManagerProyekadalahorang(person)yangbertanggungjawabuntuk mencapaitujuan proyek. • Mengelolaproyek,termasukdidalamnya : – Identifyingrequirements / Mengidentifikasi permintaan – Establishingclearandachievableobjectives/ Menetapkan tujuanyangjelasdandapat dicapai – Balancingthecompetingdemandsofquality,scope,timeandcost/ Menyeimbangkankualitasantaralingkup,waktu dan biaya – Adaptingthespecifications,plans,and approachtothedifferentconcerns and expectations ofthevarious stakeholders / Mengadaptasispesifikasi,rencanadanpendekatanataskepentingandanharapanyangberbedadaripara stakeholder • ProgressiveElaboration Terusmelakukanperbaikandanmendetailkanrencanamenjadiinformasiyangspesifikdanperkiraanyangakurat yang didapat sebagai progress proyek , sehingga menghasilkan rencana yang lebih lengkap, akurat yang merupakan hasil dari iteratsiberurutansebuah prosesperencanaan.
  6. 6. The Project Life Cycle • Siklushidupproyeadalahpenggabungandarisemuatahap/ phasedalam proyek – Semua proyek dibagi dalam tahap / phase, dan semua proyek, besar atau kecil, mempunyai struktur siklus yang mirip : mulai proyek, mengatur dan menyiapkan, melaksanakanpekerjaanproyekdanmenyelesaikan/ menutup proyek – Minimal, proyek akan memiliki awal atau tahap inisiasi, tahap menengah atau tahap- tahap,danakhirdaritahap/ phase. • Tiaptahap/ phasememilikititik akhiryang ditetapkan
  7. 7. Characteristics of Project Life Cycle • Costandstaffinglevelsarelowatthestart, peak as the workis carried out, anddroprapidly as the projectdrawstoa close. • Stakeholder influences, risk, and uncertainty, are greatest at the start of the project. These factors decrease over the life of the project. • Ability to influence the final characteristics of the project’s product, without significantly impacting cost, is highest at the start of the project and decreases as the project progresses towardscompletion. …or… The cost of changes and correcting errors typically increases substantially as the project approachescompletion.
  8. 8. Relationships Among Project Management, Program Management and Portfolio Management – ProjectManagement – ProgramManagement – PortfolioManagement – ProjectManagement Office PMO Portfolio Program Projects & Operation
  9. 9. Types of Organizational Structures Functional • Organizationisgroupedbyareas ofspecialization • Projectgenerallyoccurwithina singledepartment Projectized • Entirecompany isorganized by projects • Personnelareassignedandreport toaprojectmanager
  10. 10. Types of Organizational Structures the functional WeakMatrix • Power rest with manager • Power of project manager = coordinatororexpediter BalancedMatrix • Power is shared between the project manager and the functional manager
  11. 11. Types of Organizational Structures the project StrongMatrix • Power rest with manager Composite
  12. 12. Organizational Structure Influencesoforganizationalstructureon projects
  13. 13. Organizational Structure
  14. 14. Organizational Process Assets • Processes&Procedures – Organizationalstandardprocessessuchasstandards, policies – Standardizedguidelines,workinstruction,proposalevaluationcriteria,andperformancemeasurement criteria – Templates – Financialcontrolprocedures – Proceduresforprioritizing,approving,andissuingworkauthorization – Etc. • CorporateKnowledgeBase – Processmeasurementdatabases – Projectfiles – Historicalinformation&lessonlearnedknowledgebases – Issueanddefectmanagementdatabases – Configurationmanagementknowledgebases – Financialdatabases – Etc.
  15. 15. Enterprise Environmental Factors atau• Mengacu pada faktor lingkungan internal & eksternal yang melingkupi mempengaruhikeberhasilan proyek • Menjadiinputpadahampirseluruhprosesmanajemen proyek • Dapat memperluasataumenghambatopsi/ pilihanmanajemen proyek • Dapatmemberipengaruhpositiveataunegativeterhadap hasil • Beberapacontoh:  Budaya,strukturdanprosesOrganisasi  PeraturanPemerintah(standar)atauIndustri  Infrastruktur  Sumberdayamanusiaeksisting  Personeladministratsi  Sistemotorisasikerjadalamperusahaan  Kondisipasar  Stakeholderrisktolerances  Iklimpolitik  KetentuansalurankomunikasidiOrganisasi  Databasekomersial  Sisteminformasimanajemenproyek
  16. 16. Process Interaction • Proses manajemen proyek direpresentasikan sebagai elemen yang mempunyai ciri- definisi jelasciri denga n diantaranya• Pada overlap prakteknya, dan terjadi saling berinteraksidiantaranya I E C P M&C
  17. 17. Next topic: Project Integration Management Thank You
  18. 18. Overview Project Management Body of Knowledge (PMBOK © Guide 2013 Edition) Project IntegrationMangement
  19. 19. P r o j e c t I n t e g r a t i o n M a n a g e m e n t KnowledgeArea Process Initiating Planning Executing Monitoring&Contol Closing Integration • Develop Project Charter • DevelopProject ManagementPlan • DirectandManage ProjectExecution • MonitorandControlProject Work • PerformIntegratedChange Control • Close Project Enterphase/ Startproject Exit phase/ Endproject Initiating Processes Closing Processes Executing Processes Monitoring & Controlling Processes Planning Processes 21
  20. 20. P r o j e c t I n t e g r a t i o n M a n a g e m e n t 22
  21. 21. P r o j e c t I n t e g r a t i o n M a n a g e m e n t 23 1. Proses Integrasi Proyek Proses Tahap Proyek Deliverables Kunci Menyusun Project Charter Memulai Piagam Proyek Menyusun Rencana Manajemen Proyek Perencanaan Rencana Manajemen Proyek Langsung dan Mengelola Kerja Proyek Eksekusi Deliverables Memantau dan Pengendalian Kerja Proyek Pemantauan dan Pengendalian Perubahan Permintaan Lakukan Change Control Terpadu Pemantauan dan Pengendalian Update status Perubahan Permintaan Tutup Proyek atau Fase Penutupan Produk akhir
  22. 22. P r o j e c t I n t e g r a t i o n M a n a g e m e n t 24 2. Sebuah project charter a. Secara formal mengotorisasi proyek. b. Memberikan tujuan dan kasus bisnis c. Mengidentifikasi Manajer Proyek. d. Tidak cukup untuk mengubah sering generik. e. Ditulis oleh seorang manajer yang lebih tinggi dalam otoritas dari Project Manager. f. Termasuk nama, deskripsi, kiriman g. Sebuah proyek tidak dimulai kecuali ia memiliki piagam proyek.
  23. 23. P r o j e c t I n t e g r a t i o n M a n a g e m e n t 25 Input, Peralatan dan Teknik & Output Menyusun proses Project Charter diberikan di bawah ini. Menyusun proses Project Charter Input Alat & Teknik Output Pernyataan proyek kerja Penilaian ahli Piagam Proyek Kasus Bisnis Kontrak Faktor lingkungan perusahaan Aset proses organisasi 3. Selama pelaksanaan proyek tim proyek fokus pada menyelesaikan tugas yang diberikan. Manajemen Senior menghindari perubahan dan hilangnya sumber daya proyek. Project Manager mengintegrasikan semua bagian ke dalam proyek secara keseluruhan.
  24. 24. P r o j e c t I n t e g r a t i o n M a n a g e m e n t 5. Input, Peralatan dan Teknik, dan Output dari Menyusun Rencana Manajemen Proyek proses diberikan dalam tabel di bawah. Menyusun Proyek Proses Rencana Pengelolaan Input Alat & Teknik Output Project charter Penilaian ahli Rencana Manajemen Proyek Keluaran dari proses perencanaan Faktor lingkungan perusahaan Aset proses organisasi 6. Pada akhir setiap fase proyek, sebuah pelajaran dokumen harus disiapkan. Pelajaran dokumen mendefinisikan apa yang dilakukan dengan benar, yang salah dll Hal ini diperlukan untuk diselesaikan agar proyek akan selesai. 26
  25. 25. P r o j e c t I n t e g r a t i o n M a n a g e m e n t 27 7. Sistem Informasi Manajemen Proyek (PMIS) adalah sistem yang melacak status dari semua tugas-tugas proyek. Hal ini digunakan untuk melacak status proyek. Pada saat ujian tidak selalu pada sistem tertentu (misalnya Microsoft Project). 8. Rencana Manajemen Proyek dikembangkan oleh Project Manager dengan masukan dari tim, stakeholder dan manajemen. Pengembangan Rencana Manajemen Proyek adalah berulang. Rencana Manajemen Proyek agar dapat disetujui, realistis dan formal. 9. Rencana Manajemen Proyek meliputi - o Piagam Proyek o Anggaran belanja o Jadwal o Sumber Daya o Pernyataan Lingkup o WBS o Grafik Responsibility / tugas o Rencana Manajemen
  26. 26. P r o j e c t I n t e g r a t i o n M a n a g e m e n t 28 10. Rencana Manajemen Proyek mengkonsolidasikan rencana manajemen lainnya. Ini adalah: a. Lingkup rencana pengelolaan b. Rencana pengelolaan Kebutuhan c. Rencana pengelolaan Jadwal d. Rencana pengelolaan biaya e. Rencana manajemen mutu f. Rencana perbaikan proses g. Rencana sumber daya manusia h. Rencana manajemen komunikasi i. Rencana manajemen risiko j. Rencana pengelolaan Pengadaan Rencana Manajemen Proyek juga mencakup baseline proyek. Ini adalah: a. Jadwaldasar b. Kinerja biaya awal dan c. Lingkup dasar
  27. 27. P r o j e c t I n t e g r a t i o n M a n a g e m e n t 29 11. Baseline proyek mengacu pada versi asli dari rencana manajemen proyek. Rencana pengelolaan proyek baselined hanya sekali, hanya dapat diubah dengan mengajukan permintaan perubahan. 12. Progressive Elaborasi melibatkan proses mengambil sebuah proyek dari konsep desain rinci. 13. Kick-off meeting terjadi setelah tahap perencanaan dan sebelum pelaksanaan proyek. Hal ini biasanya digunakan untuk mengkomunikasikan tanggung jawab masing-masing pemangku kepentingan utama.
  28. 28. P r o j e c t I n t e g r a t i o n M a n a g e m e n t 30 14. Proses kerja Proyek Direct dan Mengelola meliputi pekerjaan yang didefinisikan dalam PMP untuk mencapai tujuan proyek. Proses Kerja Proyek Direct dan Mengelola Input Alat & Teknik Output Rencana pengelolaan proyek Penilaian ahli Deliverables Permintaan perubahan disetujui Sistem informasi manajemen proyek Informasi kinerja kerja Faktor-faktor lingkungan perusahaan Perubahan permintaan Aset proses organisasi Update rencana pengelolaan proyek Update dokumen proyek
  29. 29. P r o j e c t I n t e g r a t i o n M a n a g e m e n t 31 15. Memantau dan Pengendalian proses kerja proyek termasuk melacak dan meninjau kemajuan proyek. Memonitor dan Pengendalian proses pekerjaan proyek Input Alat & Teknik Output Rencana pengelolaan proyek Penilaian ahli Perubahan permintaan Laporan Kinerja Update rencana pengelolaan proyek Faktor lingkungan perusahaan Update dokumen proyek Aset proses organisasi
  30. 30. P r o j e c t I n t e g r a t i o n M a n a g e m e n t 32 16. Permintaan perubahan yang dihasilkan akan dievaluasi sebagai bagian dari Melakukan Change Control Integrated proses. Permintaan perubahan akan deliverable proyek ini dan seni dalam mengelola proyek ada di dalam proses ini Melakukan proses Integrated Change Control Input Alat & Teknik Output Rencana pengelolaan proyek Penilaian ahli Mengubah update status permintaan Informasi kinerja kerja Mengubah pertemuan kontrol Update rencana pengelolaan proyek Perubahan permintaan Update dokumen proyek Faktor lingkungan perusahaan Aset proses organisasi
  31. 31. P r o j e c t I n t e g r a t i o n M a n a g e m e n t 33 17. Ubah Control Board dibentuk untuk meninjau permintaan perubahan. Hal ini dilakukan untuk menyetujui atau menolak permintaan perubahan. Setelah ruang lingkup proyek menjadi patokan, setiap perubahan yang diminta harus melalui proses review pengendalian perubahan. 18. Manajer proyek harus proaktif dalam mencari penyimpangan dari rencana proyek dan kemudian mengambil tindakan korektif tepat waktu. Setelah itu Manajer Proyek perlu mengevaluasi efektivitas tindakan korektif, dan mengukur kinerja tindakan korektif, dan kemudian menentukan perlunya tindakan korektif lanjutan.
  32. 32. P r o j e c t I n t e g r a t i o n M a n a g e m e n t 34 19. Ketika permintaan perubahan diterima, langkah-langkah berikut harus diambil (dalam urutan ini) - a. Evaluasi (menilai) dampak perubahan proyek b. Buat alternatif termasuk pemotongan tugas-tugas lain, crashing, fast-tracking, dll c. Bertemu dengan manajemen, sponsor dan lain-lain d. Bertemu dengan pelanggan jika diperlukan Tutup Proyek atau Fase adalah proses penyelesaian formal semua kegiatan proyek terkait. Input, Peralatan dan Teknik dan Output dari proses ini diberikan di bawah ini.
  33. 33. P r o j e c t I n t e g r a t i o n M a n a g e m e n t 35 Tutup Proyek atau Fase Input Alat & Teknik Output Rencana pengelolaan proyek Penilaian ahli Produk akhir, layanan atau hasil transisi Kiriman Diterima Update aset proses organisasi Aset proses organisasi Pada akhir setiap fase proyek, sebuah pelajaran dokumen harus disiapkan. Pelajaran dokumen mendefinisikan apa yang dilakukan dengan benar, yang salah, dll. Hal ini diperlukan untuk dilakukan agar proyek dapat diselesaikan.
  34. 34. 36
  35. 35. Overview Project Management Body of Knowledge (PMBOK © Guide 2013 Edition) Project Scope Mangement
  36. 36. 38 5. P r o j e c t S c o p e M a n a g e m e n t KnowledgeArea Process Initiating Planning Executing Monitoring&Contol Closing Scope PlanScopeManagement CollectRequirements DefineScope CreateWBS ValidateScope ControlScope Enterphase/ Startproject Exit phase/ Endproject Initiating Processes Closing Processes Executing Processes Monitoring & Controlling Processes Planning Processes
  37. 37. 39 p r o j e c t S c o p e M a n a g e m e n t
  38. 38. 40 p r o j e c t S c o p e M a n a g e m e n t Bab ini mencakup konsep-konsep kunci yang berkaitan dengan Proyek Ruang Lingkup Manajemen. 1. Area pengetahuan Ruang Lingkup Manajemen Proyek terdiri dari proses berikut - Proses Manajemen Ruang Lingkup Proses Proyek Grup Deliverables Kunci Rencana Pengelolaan Ruang Lingkup Perencanaan Kumpulkan Persyaratan Perencanaan Dokumen persyaratan Tentukan Lingkup perencanaan Pernyataan lingkup proyek Buat WBS perencanaan WBS, WBS kamus Validasi Lingkup Pemantauan dan Pengendalian Penerimaan kiriman Control Lingkup Pemantauan dan Pengendalian Perubahan Permintaan
  39. 39. 41 p r o j e c t S c o p e M a n a g e m e n t 2. Area pengetahuan Ruang Lingkup Manajemen mencakup proses-proses yang diperlukan untuk memastikan bahwa proyek tersebut mencakup semua pekerjaan, dan hanya semua pekerjaan yang diperlukan untuk menyelesaikan proyek dengan sukses. Hal ini terutama berkaitan dengan mengendalikan apa yang masuk dan apa yang tidak termasuk ruang lingkup. 3. Project Portfolio Management adalah proses pemilihan proyek. Ini melibatkan pembuatan keputusan tentang perkiraan yang seharusnya dilakukan oleh Organisasi. 4. Ada dua jenis metode pemilihan proyek. Ini adalah a. Manfaat Pengukuran (Benefits Measurement) b. Optimasi Dibatasi (Constrained Optimization)
  40. 40. 42 p r o j e c t S c o p e M a n a g e m e n t 5. Metode seleksi proyek Manfaat Pengukuran melibatkan perbandingan nilai-nilai dari satu proyek terhadap yang lain. Berikut jenis teknik seleksi proyek Manfaat Pengukuran a. Muder Boards - ini melibatkan komite mengajukan pertanyaan-pertanyaan sulit dari setiap proyek b. Scoring Model - proyek yang berbeda diberikan skor berdasarkan kriteria tertentu yang telah ditentukan. Proyek dengan skor yang lebih tinggi dipilih. c. Benefits Cost Ratio - Teknik ini melibatkan manfaat komputasi untuk ratio (BCR) biaya untuk sebuah proyek. Proyek dengan tinggi BCR dipilih. d. Payback period - Teknik ini melibatkan mempertimbangkan berapa lama waktu yang dibutuhkan untuk kembali "membayar kembali" biaya proyek. Inflasi atau bunga yang diperoleh tidak dipertimbangkan dalam teknik ini. Sebuah proyek dengan Payback period dengan periode yang lebih baik. e. Discounted Cash Flow - Teknik ini memperhitungkan bunga yang diperoleh pada uang. Nilai Masa Depan (FV) dari proyek dibandingkan. FV = PV (1 + i) n PV adalah nilai sekarang dari proyek. Sebuah proyek dengan nilai sekarang lebih tinggi yang lebih baik. f. Internal Rate of Return (IRR) - Sebuah proyek yang memiliki IRR yang lebih tinggi lebih baik, seperti memberikan pengembalian yang lebih tinggi pada uang.
  41. 41. 43 p r o j e c t S c o p e M a n a g e m e n t 6. Constrained Optimization Project selection digunakan untuk proyek-proyek besar. Ini adalah teknik didasarkan pada model matematika. Constrained Optimization techniques antar lain a. Linear Programming b. Non-Linear Programming c. Integer Algorithm d. Dynamic Programming e. Multi-objective Programming 7. Nilai moneter yang diharapkan dari sebuah proyek (atau nilai yang diharapkan) adalah sama dengan dampak probabilitas. Jadi jika probabilitas keberhasilan sebuah proyek adalah 20% dan pendapatan yang diperoleh jika berhasil adalah $ 100.000, maka nilai bersih proyek akan menjadi $ 20.000. Saat melakukan pemilihan proyek, sebuah proyek dengan nilai bersih lebih tinggi yang harus dipilih.
  42. 42. 44 p r o j e c t S c o p e M a n a g e m e n t 8. Proses mengumpulkan Persyaratan melibatkan mendokumentasikan kebutuhan stakeholder untuk memenuhi tujuan proyek. Kumpulkan Persyaratan Proses (Collect Requirements Process) Input Alat & Teknik Output Project charter Wawancara Persyaratan dokumentasi Stakeholder mendaftar (Stakeholderregister) Focusgroups Rencana pengelolaan Persyaratan Facilitated workshops Persyaratan traceability matrix Group creativity techniques Questionaires and surveys Observations Prototypes Group decision-making techniques
  43. 43. 45 p r o j e c t S c o p e M a n a g e m e n t 10. Tentukan proses Lingkup (Define Scope) mendefinisikan penjelasan rinci tentang proyek dan penyerahan utama. Tentukan Proses Lingkup (Define Scope Process) Input Alat & Teknik Output Project charter Penilaian ahli Pernyataan lingkup proyek Persyaratan dokumentasi Analisis produk Update dokumen proyek Aset proses organisasi Identifikasi Alternatif Facilitated workshops 11. Buat WBS adalah proses membagi deliverable proyek menjadi komponen yang lebih kecil. Buat WBS Proses Input Alat & Teknik Output Pernyataan Proyek Lingkup Penguraian WBS Persyaratan dokumentasi WBS kamus Aset proses organisasi Lingkup dasar Update dokumen proyek
  44. 44. p r o j e c t S c o p e M a n a g e m e n t 12. Struktur Perincian Kerja (WBS) adalah bagian penting dari ujian. Ini adalah representasi grafis dari hirarki proyek. The WBS template dapat digunakan kembali di seluruh proyek. WBS memaksa tim proyek untuk berpikir melalui semua tingkat proyek. Jika tugas tidak dalam WBS, maka itu bukan bagian dari proyek. 13. 8/80 aturan untuk WBS - Tidak ada tugas harus kurang dari 8 jam atau lebih dari 80 jam. 14. WBS kamus menjelaskan semua komponen WBS. Juga WBS adalah masukan untuk sebagian besar proses perencanaan. Secara khusus WBS adalah input ke proses berikut - o Biaya Memperkirakan o Biaya Penganggaran o Control Lingkup o Kegiatan Definition o Pembelian rencana dan Akuisisi 15. The Validasi Lingkup adalah proses di mana pelanggan proyek secara resmi menerima deliverable proyek. Lingkup Validasi terjadi pada akhir setiap tahap. Selama Validasi proses Lingkup pelanggan memberikan umpan balik pada pekerjaan yang dilakukan. Sedangkan proses Lingkup Validasi berfokus pada penerimaan pelanggan, Lakukan proses Quality Control berfokus pada kebenaran kerja. 46
  45. 45. 47 p r o j e c t S c o p e M a n a g e m e n t Validasi Proses Lingkup Input Alat & Teknik Output Rencana pengelolaan proyek Pemeriksaan Deliverables Diterima Persyaratan dokumentasi Perubahan permintaan Persyaratan traceability matrix Update dokumen proyek Kiriman divalidasi 16. Proses Lingkup Pengendalian melibatkan pemantauanstatus proyek dan mengelola perubahan lingkup. 17. Kontrol Proses Lingkup Input Alat & Teknik Output Rencana pengelolaan proyek Analisis varians Pengukuran kinerja kerja Persyaratan dokumentasi Perubahan permintaan Persyaratan traceability matrix Update rencana pengelolaan proyek Aset proses organisasi Update aset proses organisasi Informasi kinerja kerja Update dokumen proyek
  46. 46. 18/08/2015 48
  47. 47. Next topic: Project Time Management Thank You
  48. 48. Overview Project Management Body of Knowledge (PMBOK © Guide 2013 Edition) Project Time Mangement
  49. 49. KnowledgeArea Process Initiating Planning Executing Monitoring& Control Closing Time PlanScheduleManagement DefineActivities SequenceActivities EstimateActivityResources EstimateActivityDurations DevelopSchedule ControlSchedule Enterphase/ Startproject Exit phase/ Endproject Initiating Processes Closing Processes Executing Processes Monitoring & Controlling Processes Planning Processes 6 P r o j e c t Time M a n a g e m e n t 51
  50. 50. P r o j e c t Time M a n a g e m e n t 52
  51. 51. P r o j e c t Time M a n a g e m e n t 53 Bab ini mencakup konsep-konsep yang uatama berkaitan dengan Proyek Manajemen Waktu. 1. Area pengetahuan Proyek Manajemen Waktu terdiri dari proses berikut – Proses Manajemen Waktu Proses TahapProyek DeliverablesKunci Jadwal Rencana Pengelolaan Perencanaan Kegiatan Tentukan Perencanaan Daftar kegiatan, daftar Milestone UrutanKegiatan Perencanaan Diagram jaringan Jadwal Proyek Perkiraan Kegiatan Resources Perencanaan Kebutuhan sumber daya kegiatan, kerusakan struktur Sumber Daya Perkiraan Kegiatan Durasi Perencanaan Perkiraan durasi aktivitas MenyusunJadwal Perencanaan JadwalProyek Jadwal Kontrol Pemantauan dan Pengendalian Pengukuran Kinerja Kerja, Perubahan Permintaan
  52. 52. P r o j e c t Time M a n a g e m e n t 54 Tentukan Kegiatan Proses (Define Activities) Input Alat dan Teknik Output Lingkup dasar Penguraian Daftar Kegiatan Faktor lingkungan perusahaan Bergulir perencanaan gelombang (Rolling wave planning Atribut Kegiatan Aset proses organisasi Template Daftar Milestone Penilaian ahli 2. Urutan KegiatanProses Input Alat dan Teknik Output Pernyataan lingkup proyek Metode precedence diagram (PDM) atau AON Diagram jaringan jadwal proyek Daftar Kegiatan Menerapkan memimpin dan tertinggal Update dokumen proyek Atribut Kegiatan Jadwal Template Jaringan Daftar Milestone Penentuan Ketergantungan Aset proses organisasi
  53. 53. P r o j e c t Time M a n a g e m e n t 55 3. Sumber Daya Perkiraan Kegiatan Proses Input Alat dan Teknik Output Daftar Kegiatan Penilaian ahli Kebutuhan sumber daya Activity Atribut Kegiatan Analisis Alternatif Kerusakan struktur sumber daya Kalender sumber daya Diterbitkan mengestimasi data (Published estimating data) Update dokumen proyek Faktor lingkungan perusahaan Bottom-up memperkirakan Aset proses organisasi Software Manajemen Proyek 4. Perkiraan Kegiatan Durasi Proses Input Alat dan Teknik Output Daftar Kegiatan Penilaian ahli Perkiraan durasi aktivitas Atribut Kegiatan Memperkirakan Analog Update dokumen proyek Kebutuhan sumber daya Activity Estimasi parametrik Kalender sumber daya Perkiraan tiga titik Pernyataan lingkup proyek Analisis cadangan Faktor lingkungan perusahaan Aset proses organisasi
  54. 54. P r o j e c t Time M a n a g e m e n t 56 5. Menyusun Jadwal Proses Input Alat dan Teknik Output Aset proses organisasi Analisis jaringan Jadwal Jadwal Proyek Pernyataan lingkup proyek Metode jalur kritis Jadwal dasar Daftar Kegiatan Kompresi Jadwal Data jadwal Atribut Kegiatan Apa-jika analisis skenario Update dokumen proyek Diagram Proyek Jadwal Jaringan Resource leveling Kebutuhan sumberdaya Kegiatan Metode rantai kritis Sumber Daya Kalender Penjadwalan alat Perkiraan durasi aktivitas Menerapkan kalender Rencana Manajemen Proyek - Risk Register Menyesuaikan Memimpin dan Lambannya Faktor lingkungan perusahaan
  55. 55. P r o j e c t Time M a n a g e m e n t 57 6. Jadwal Kontrol Proses Input Alat dan Teknik Output Rencana pengelolaan proyek Ulasan kinerja Pengukuran kinerja kerja Jadwal proyek Analisis varians Update aset proses organisasi Informasi kinerja kerja Perangkat lunak manajemen proyek Perubahan permintaan Aset proses organisasi Resource leveling Update rencana pengelolaan proyek Apa-jika analisis skenario Update dokumen proyek Menyesuaikan memimpin dan tertinggal Kompresi Jadwal Penjadwalan alat
  56. 56. P r o j e c t Time M a n a g e m e n t 58 7. Grafik batang (atau grafik Gantt) digunakan untuk menampilkan tugas dan tanggal mereka dalam mode grafis. Mereka digunakan untuk menampilkan informasi dari jenis tugas 1 dijadwalkan dari tanggal A ke B. Biasanya rentang tanggal yang ditampilkan dalam sumbu X dan tugas-tugas pada Y-axis. Grafik batang tidak menunjukkan dependensi tugas. Mereka umumnya digunakan untuk melacak kemajuan dan menunjukkan kepada tim. 8. Milestone grafik mirip dengan bar chart, tetapi hanya menampilkan peristiwa besar. Mereka menampilkan tonggak utama (untuk contoh desain jembatan selesai). Mereka digunakan untuk melaporkan status untuk Manajemen. 9. Diagram jaringan yang digunakan untuk menampilkan kegiatan dan dependensi mereka. Diagram jaringan dapat digunakan untuk melakukan analisis jalur kritis. . Diagram jaringan juga dapat digunakan untuk melakukan menabrak dan cepat pelacakan proyek
  57. 57. P r o j e c t Time M a n a g e m e n t 59 Ada dua jenis diagram jaringan - o Kegiatan pada Node (atau Precedence) o Kegiatan di panah (atau AOA) Diutamakan ini paling sering digunakan. AON dan AOA tidak dapat memiliki loop atau hubungan bersyarat. 10. Sebuah kegiatan dalam diagram jaringan akan ditampilkan seperti yang ditunjukkan di bawah ini. Nama Kegiatan Kegiatan Nomor Perkiraan 11. Sebagai contoh - Dokumentasi 2 5 hari 12. Dalam contoh di atas Dokumentasi adalah kegiatan nomor 2 dan diperkirakan berlangsung 5 hari
  58. 58. P r o j e c t Time M a n a g e m e n t 60 13. Precedence (atau Kegiatan pada Node) diagram dapat digunakan untuk menampilkan empat jenis hubungan antara kegiatan. Ini adalah oFinish-To-Start o Start-To-Start o Start-To-Finish o Finish-To-Finish Hubungan Finish-to-start berarti aktivitas tergantung tidak dapat dimulai sampai kegiatan pertama selesai. Ini adalah cara paling umum untuk mewakili hubungan antara kegiatan. 14. Kegiatan pada Array (AOA) diagram jaringan memiliki karakteristik sebagai berikut. o AOA hanya menggunakan hubungan Finish-To-Start antara tugas-tugas. o PERT dan CPM hanya dapat digunakan dengan AOA. o Peristiwa Dummy ditunjukkan dengan garis putus-putus. Mereka tidak mengambil waktu.Mereka menunjukkan ketergantungan antara tugas.
  59. 59. P r o j e c t Time M a n a g e m e n t 61 15. Jalan terpanjang melalui diagram jaringan disebut jalur kritis. Kegiatan pada jalur kritis disebut kegiatan kritis. 16. Lambannya dimasukkan waktu tunggu di antara tugas-tugas. Misalnya Task B tidak bisa dimulai sampai tiga hari setelah tugas A selesai. 17. Slack atau float adalah jumlah waktu tugas dapat ditunda tanpa menunda proyek. Tugas pada jalur kritis memiliki nol mengambang. 18. Critical Path Method (CPM)memiliki karakteristik sebagai berikut. o Menggunakan satu perkiraan waktu per kegiatan o Hal ini dapat ditarik hanya menggunakan diagram AOA o Hal ini dapat memiliki acara boneka
  60. 60. P r o j e c t Time M a n a g e m e n t 62 19. Evaluasi Program dan Review Technique (PERT) memiliki karakteristik sebagai berikut. o Ini menggunakantiga perkiraan per kegiatan - optimis, pesimis dan kemungkinan besar o Hal ini dapat ditarik hanya menggunakan diagram AOA o Hal ini dapat memiliki acara boneka 20. PERT menggunakaninformasi lebih dari BPT karena mempertimbangkan"Pesimistis" dan "Optimis" nilai-nilai selain "Paling Mungkin"nilai dalamperhitungannya. Berikut ini adalah formula yang digunakan oleh PERT - Berarti = (P + 4M+ O) / 6 = Standar Deviasi (PO) / 6 Variance = ((PO) / 6) 2 Berikut P adalahperkiraan pesimis,O adalah optimis perkiraan dan Madalah perkiraan yang paling mungkin. 21. Gert adalah jenis lain dari diagram jaringan. Hal ini dapat mendukung perulangan. Jika proyek memiliki lebih dari satu jalur kritis maka risiko meningkat proyek. Resource leveling mengacu menjaga sumber daya yang sama di seluruh durasi proyek.
  61. 61. Next topic: Project Cost Management Thank You 63
  62. 62. Overview Project Management Body of Knowledge (PMBOK © Guide 2013 Edition) Project Cost Management
  63. 63. P r o j e c t C o s t M a n a g e m e n t KnowledgeArea Process Initiating Planning Executing Monitoring& Control Closing Cost PlanManagementCost EstimateCosts DetermintBudge ControlCost Enterphase/ Startproject Exit phase/ End project Initiating Processes Closing Processes Planning Processes Executing Processes Monitoring & Controlling Processes
  64. 64. 7. P r o j e c t C o s t M a n a g e m e n t
  65. 65. 7. P r o j e c t C o s t M a n a g e m e n t Bab ini mencakup konsep-konsep kunci yang berkaitan dengan Manajemen Biaya Proyek. 1. Biaya Proyek Proses Proses Tahap Proyek Deliverables Kunci Rencana Pengelolaan Biaya Perencanaan Biaya Perkiraan Perencanaan Perkiraan Kegiatan Biaya, Dasar perkiraan Tentukan Anggaran Perencanaan Kinerja biayaawal Biaya kontrol Pemantauan dan Pengendalian Pengukuran kinerja kerja 2. Proses alternatif identifikasi dalam mengidentifikasi solusi lain untuk masalah yang diidentifikasi. 3. Pendekatan Analisis Nilai digunakan untuk mencari yang lebih terjangkau, metode yang tidak mahal untuk menyelesaikan tugas yang sama.
  66. 66. 7. P r o j e c t C o s t M a n a g e m e n t 4. Proses Biaya Perkirakan mengambil input berikut - o Lingkup dasar o Jadwal proyek o Rencana sumber daya manusia o Daftar risiko o Faktor lingkungan perusahaan o Aset proses organisasi 5. Penyusutan adalah teknik yang digunakan untuk menghitung perkiraan nilai benda apapun setelah beberapa tahun. Ada tiga jenis teknik penyusutan. Ini adalah o Garis lurus penyusutan Jumlah yang sama sudah ditinggalkan (dikurangi) dari biaya setiap tahun. o Menurun ganda keseimbangan - Pada tahun pertama ada pemotongan yang lebih tinggi dalam nilai - dua kali jumlah garis lurus. Setiap tahun setelah itu pengurangan adalah 40% kurang dari tahun sebelumnya. o Sum tahun penyusutan - Katakanlah kehidupan obyek adalah lima tahun. Total satu sampai lima adalah lima belas. Pada tahun pertama kami menyimpulkan 15/5 dari biaya, di tahun kedua kita menyimpulkan 15/4, dan seterusnya.
  67. 67. 7. P r o j e c t C o s t M a n a g e m e n t 6. Memperkirakan analog adalah teknik estimasi dengan karakteristik sebagai berikut - o Perkiraan didasarkan pada proyek-proyek masa lalu (informasi sejarah) o Hal ini kurang akurat bila dibandingkan dengan estimasi bottom-up o Ini adalah pendekatan top-down o Dibutuhkan waktu kurang bila dibandingkan dengan estimasi bottom-up o Ini adalah bentuk penilaian ahli 7. Dalam Parametric Modeling Estimasi , Anda menggunakan model matematis untuk membuat perkiraan. Ini adalah dua jenis. o Analisis Regresi adalah model matematika berdasarkan informasi historis. o Belajar Curve Model didasarkan pada prinsip bahwa biaya per unit menurun karena lebih banyak pekerjaan akan selesai. 6. Bottom up estimasi sama dengan estimasi WBS. Ini melibatkan memperkirakan setiap item pekerjaan dan menambahkan perkiraan untuk mendapatkan estimasi total proyek.
  68. 68. 7. P r o j e c t C o s t M a n a g e m e n t Andadapatmengharapkan5-10pertanyaanterkait denganEarned Value Management.Biasanyaini cukupsederhanasekaliAndamemilikipemahamanyangbaik tentang konsep-konsep,daningatrumus.Formulaini dijelaskan di bawah ini. 9. PlannedValue(PV)mengacupadaapa proyekharusbernilaipadasaat inidalam jadwal. Halinijuga disebutsebagaiBCWS(BiayaAnggaranKerja Terjadwal). 10. EarnedValue(EV)adalahpekerjaanfisik selesai sampaisaat inidananggaranyang berwenanguntukitu. Halini juga disebutsebagaiBCWP(AnggaranBiaya Kerja Performed). 11. Biaya Sesungguhnya(AC) adalahjumlahsebenarnyauangyangdihabiskansejauh ini. Halini jugadisebutsebagaiACWP(BiayaSesungguhnyaKerja Performed). 12. PerkiraanSesungguhnyaCompletion(EAC) mengacupadaperkiraan biaya total proyek dipenyelesaian. 13. CPI mengacuBiaya PerformanceIndex.Halini didefinisikansebagaiCPI=EV/ ACJika CPIkurang dari 1, ini berarti bahwaproyek ini melebihi anggaran.
  69. 69. 7. P r o j e c t C o s t M a n a g e m e n t 14. BAC mengacu pada Anggaran Penyelesaian. Hal ini terkait dengan EAC. EAC = BAC / CPI 15. ETC mengacu Perkirakan ke Completion. Hal ini didefinisikan sebagai ETC = EAC - AC 16. CV mengacu Biaya Variance. Hal ini didefinisikan sebagai CV = EV - AC 17. SV mengacu pada Jadwal Variance. Hal ini didefinisikan sebagai SV = EV - PV biaya negatif atau varians jadwal berarti bahwa proyek berada di belakang dalam biaya atau jadwal. 18. SPI mengacu pada Jadwal Performance Index. Hal ini didefinisikan sebagai SPI = EV / PV 19. VAC mengacu Variance At Completion. Hal ini didefinisikan sebagai VAC = BAC - EAC
  70. 70. 7. P r o j e c t C o s t M a n a g e m e n t 20. Proses penganggaran Biaya mendefinisikan waktu bertahap perkiraan biaya untuk proyek tersebut. Sebagai contoh, pada bulan pertama proyek ini akan membutuhkan $ 10.000. Estimasi biaya melibatkan perkiraan biaya yang menentukan untuk tugas- tugas. Biaya penganggaran mendefinisikan perkiraan biaya sepanjang waktu. 21. Alat-alat dan teknik yang digunakan untuk Biaya Perkirakan adalah - o Penilaian ahli o Memperkirakan Analog o Estimasi parametrik o Bottom-up memperkirakan o Perkiraan tiga titik o Analisis cadangan o Biaya kualitas o Manajemen Proyek memperkirakan perangkat lunak o Analisis tawaran penjual 22. Biaya dasar mengacu pada apa yang diharapkan akan dihabiskan untuk proyek tersebut. Ini biasanya merupakan S-kurva. Itu adalah pengeluaran kurang di awal, dan akhir. Pengeluaran tersebut adalh maksimum selama pertengahan proyek. Biaya proyek disebut biaya siklus hidup.
  71. 71. E a r n e d V a l u e M a n a g e m e n t • Metode untuk mengukur kinerja proyek terhadap lingkup, jadwal, dan biaya awal (performance measurement baseline) • Interpretasi ukuran kinerja dasar EVM a. Cost Performance Index (CPI) b. Schedule Performance Index (SPI) Image captured from Practice Standard for Earned Value Management, PMI © 2005
  72. 72. E a r n e d V a l u e M a n a g e m e n t • Meodapengkuranperformansiprojecttentangrisikoscope,scheduleandcostbaseline (performancemeasurementbaseline) • PengertianyangmendasardariEVMadalah denganmengukur – CostPerformanceIndex (CPI) – SchedulePerformanceIndex (SPI) Image captured from Practice Standard for Earned Value Management, PMI © 2005
  73. 73. Earned Value Technique Revised TotalDuration Baseline Duration/Schedule Performance Index 4/0.33 = 12 months
  74. 74. Earned Value Technique Revised TotalDuration Baseline Duration/Schedule Performance Index 4/0.33 = 12 months
  75. 75. Earned Value Technique Terms and Formulas Definition Budgetatcompletion(BAC) Budget yangdisediakansampaidenganproyek selesai. EstimateatCompletion(EAC) =BAC/ CPI Perkiraanbiayayangdikeluarkansampaidenganproyekselesai. EstimatetoComplete(ETC) =EAC-AC Perkiraanbiayayangmasihdiperlukansampaidenganproyek selesai. VarianceatCompletion(VAC) =BAC– EAC Kelebihanataukeuranganbiayayangdiperlukansampaidenganproyek selesai. • EACisanimportantforecasting value.
  76. 76. Next topic: Project Quality Management Thank You
  77. 77. Overview Project Management Body of Knowledge (PMBOK © Guide 2013 Edition) Project Quality Management
  78. 78. 8. P r o j e c t Qu a lit y M a n a g e m e n t KnowledgeArea Process Initiating Planning Executing Monitoring&Contol Closing Cost PlanQuality Management PerformQuality Assurance ControlQuality Enterphase/ Startproject Exit phase/ Endproject Initiating Processes Closing Processes Executing Processes Monitoring & Controlling Processes Planning Processes
  79. 79. P r o j e c t Qu a lit y M a n a g e m e n t
  80. 80. P r o j e c t Qu a lit y M a n a g e m e n t Bab ini mencakup konsep-konsep kunci yang berkaitan dengan Proyek Manajemen Mutu. 1. Area pengetahuan Proyek Manajemen Mutu terdiri dari proses berikut - Kualitas Proses Manajemen Proses Tahap Proyek Deliverables Kunci Managment Rencana Kualitas Perencanaan Rencana Manajemen Mutu, Kualitas Metrik Melakukan Quality Assurance Eksekusi Perubahan Permintaan Melakukan Quality Control Pemantauan dan Pengendalian Pengukuran kontrol kualitas 2. Proses Rencana Manajemen Mutu mencakup mendefinisikan persyaratan kualitas proyek dan mendokumentasikan bagaimana proyek akan memastikan kepatuhan.
  81. 81. P r o j e c t Qu a lit y M a n a g e m e n t 3. Proses Rencana Kualitas Input Alat dan Teknik Output Lingkup dasar Analisis biaya-manfaat Rencana manajemen mutu Stakeholder mendaftar Biaya kualitas Metrik kualitas Kinerja biaya awal Diagram kontrol Pemeriksaan kualitas Jadwal dasar Benchmarking Rencana perbaikan proses Daftar risiko Desain eksperimen Update dokumen proyek Faktor lingkungan perusahaan Sampling stastical Aset proses organisasi Flowcharting Metodologi manajemen mutu Proprietary Alat perencanaan kualitas Tambahan 4. Kelas mengacu pada kategori atau peringkat yang diberikan kepada entitas yang memiliki penggunaan fungsional yang sama tetapi karakteristik teknis yang berbeda. Sebagai contoh, untuk nilai yang berbeda dari hotel, harapan pelanggan juga berbeda.
  82. 82. P r o j e c t Qu a lit y M a n a g e m e n t 5. Tujuan kualitas adalah untuk memastikan "Kesesuaian dengan persyaratan" dan "kesesuaian untuk digunakan". 6. Kebijakan Kualitas mendefinisikan tujuan perusahaan dan bagaimana untuk mematuhi mereka. Ini bertindak sebagai masukan untuk Perencanaan Kualitas untuk sebuah proyek. Kebijakan Mutu adalah bagian dari Organisasi aset Process. 7. Deming menyarankan proses Plan-Do-Check-Act untuk meningkatkan kualitas. Menurut Deming, setiap proses harus melalui langkah-langkah untuk meningkatkan kualitas. 8. Kaizen Teori - Terapkan perbaikan kecil terus menerus untuk mengurangi biaya dan menjamin konsistensi. 9. Marginal Analysis - Anda membandingkan biaya perbaikan inkremental terhadap peningkatan pendapatan terbuat dari peningkatan kualitas. Kualitas optimal tercapai saat biaya perbaikan sama dengan biaya untuk mencapai kualitas.
  83. 83. P r o j e c t Qu a lit y M a n a g e m e n t 10. Nilai sigma Distribusi normal diberikan di bawah ini. Ini penting untuk ujian. Nilai Sigma Distribusi yang normal Sigma Persentase tertutup Satu sigma 68,26% Dua sigma 95.46% Tiga sigma 99,73% Six sigma 99,99% Berdasarkan tabel di atas, kita dapat melihat bahwa dalam enam sigma satu dari 10.000 item dapat memiliki cacat. Dalam tiga sigma dua puluh tujuh dari 10.000 item dapat memiliki cacat. 11. Memberikan tambahan yaitu melakukan lebih dari ruang lingkup proyek disebut gold- plating. PMI tidak merekomendasikan gold-plating. 12. Kualitas harus direncanakan dan tidak diperiksa masuk Pencegahan lebih penting daripada inspeksi.
  84. 84. P r o j e c t Qu a lit y M a n a g e m e n t 13. Quality Assurance dilakukan selama pelaksanaan proyek. Ini mencakup - o Proses evaluasi kinerja keseluruhan secara teratur o Re-evaluasi standar kualitas o Kualitas audit - Tinjauan terstruktur kegiatan berkualitas yang mengidentifikasi pelajaran. Pelajaran ini dipelajari digunakan untuk perbaikan proses. Melakukan Quality Assurance melibatkan meninjau persyaratan mutu dan audit hasil dari pengukuran kontrol kualitas. Melakukan Quality Assurance menggunakan data yang dibuat selama Melakukan Quality Control. ITTO dari Melakukan Quality Assurance Input Alat danTeknik Output Rencana pengelolaan proyek Rencanakan Kualitas dan Melakukan Pengendalian Mutu alat dan teknik Update proses organisasi Metrik kualitas Kualitasaudit Perubahan permintaan Informasi kinerja kerja Prosesanalisis Update rencana pengelolaan proyek Pengukuran kontrol kualitas Update dokumen proyek Pengendalian Lakukan Kualitas berfokus pada perbaikan kerja.
  85. 85. P r o j e c t Qu a lit y M a n a g e m e n t 14. Melakukan Quality Control Input Alat dan Teknik Output Rencana pengelolaan proyek Sebab dan akibat diagram Pengukuran kontrol kualitas Metrik kualitas Diagram kontrol Perubahan divalidasi Pemeriksaan kualitas Flowcharting Kiriman divalidasi Pengukuran kinerja kerja Histogram Update aset proses organisasi Permintaan perubahan disetujui Pareto grafik Perubahan permintaan Deliverables Jalankan grafik Update rencana pengelolaan proyek Aset proses organisasi Diagram pencar Update dokumen proyek Sampling statistik Pemeriksaan Permintaan perubahan disetujui ulasan
  86. 86. P r o j e c t Qu a lit y M a n a g e m e n t Di Just-In-Time (JIT) Kualitas, jumlah persediaan adalah nol. Input yang dibuat tersedia, hanya ketika mereka diperlukan. Hal ini akan mengurangi biaya penyimpanan. 15. Rule of Seven : Dalam diagram kontrol, jika ada tujuh poin di satu sisi berarti, maka penyebab dialihkan harus ditemukan. 16. Proses Analog Estimasi melibatkan melihat sejarah proyek masa lalu, dan menggunakannya untuk membuat estimasi.
  87. 87. Next topic: Project Human Resource Management Thank You
  88. 88. Overview Project Management Body of Knowledge (PMBOK © Guide 2013 Edition) Project Human Resource Management
  89. 89. Project Human Resource Management KnowledgeArea Process Initiating Planning Executing Monitoring& Contol Closing Human Resource PlanHumanResource Management Acquire Project Team Develop Project Team ManageProject Team Enterphase/ Startproject Exit phase/ Endproject Initiating Processes Closing Processes Executing Processes Monitoring & Controlling Processes Planning Processes P r o j e c t Human R e s o u r c e M a n a g e m e n t
  90. 90. P r o j e c t Human R e s o u r c e M a n a g e m e n t
  91. 91. P r o j e c t Human R e s o u r c e M a n a g e m e n t Bab ini mencakup konsep-konsep kunci yang berkaitan dengan Manajemen Sumber Daya Manusia Proyek. 1. Area pengetahuan Manajemen Sumber Daya Manusia Proyek terdiri dari proses berikut - Proses Manajemen Sumber Daya Manusia Proses Tahap Proyek Deliverables Kunci Rencana Pengelolaan Sumber Daya Manusia Perencanaan Rencana Sumber Daya Manusia Memperoleh Tim Proyek Eksekusi Tugas Staf Proyek Menyusun Tim Proyek Eksekusi Penilaian kinerja Team Mengelola Tim Proyek Eksekusi Perubahan permintaan Rencana Manusia Proses Manajemen Sumber Daya melibatkan mengidentifikasi dan mendokumentasikan peran dan tanggung jawab proyek.
  92. 92. P r o j e c t Human R e s o u r c e M a n a g e m e n t 2. Proses Rencana Pengelolaan Sumber Daya Manusia Input Alat dan Teknik Output Faktor lingkungan perusahaan Bagan organisasi dan deskripsi jabatan Rencana sumber daya manusia Aset proses organisasi Teori Organisasi Kebutuhan sumber daya Activity Networking 3. Acquire project team mencakup mengidentifikasi dan mendapatkan tim yang diperlukan untuk melaksanakan proyek tersebut. Memperoleh proses tim proyek Input Alat dan Teknik Output Rencana pengelolaan proyek Pre-tugas Tugas staf proyek Faktor lingkungan perusahaan Perundingan Kalender sumber daya Aset proses organisasi Perolehan Update rencana pengelolaan proyek Tim Virtual
  93. 93. P r o j e c t Human R e s o u r c e M a n a g e m e n t 4. Proses tim Menyusun proyek melibatkan meningkatkan kompetensi anggota tim dan meningkatkan kerja sama antara tim. 5. Menyusun proses tim proyek Input Alat dan Teknik Output Penugasan staf proyek Keterampilan interpersonal Penilaian kinerja Team Rencana pengelolaan proyek Latihan Perusahaan faktor lingkungan update Kalender sumber daya Tim kegiatan pembangunan Aturan dasar Co-location Pengakuan dan penghargaan 6. Tugas Tanggung Jawab Matrix (RAM= Responsibility Assignment Matrix) mendefinisikan siapa yang melakukan apa. The Staffing Management Plan mendefinisikan kapan orang ditambahkan dan dihapus dari proyek tersebut.
  94. 94. P r o j e c t Human R e s o u r c e M a n a g e m e n t 7. Sebuah Manajer Proyek dapat menghasilkan otoritas atas tim proyek di salah satu cara berikut - o Referent - tim proyek mengetahui PM o Formal Kekuasaan - Kekuasaan karena posisi Manajer Proyek o Teknis Tenaga - Project Manager memiliki keterampilan teknis yang kuat dalam domain proyek. o Koersif Kekuasaan - Tim proyek takut kekuasaan Manajer Proyek memegang. 8. Konflik dalam tim disebabkan karena alasan-alasan berikut dalam urutan penurunan kejadian. o Jadwal o Prioritas Proyek o Sumber Daya o Pendapat Teknis Jadi penyebab paling umum dari konflik dalam proyek-proyek adalah isu-isu yang berkaitan dengan jadwal. Konflik yang terbaik diselesaikan oleh orang-orang dalam tim.
  95. 95. P r o j e c t Human R e s o u r c e M a n a g e m e n t 9. Ada teknik resolusi konflik standar yang tersedia untuk menyelesaikan konflik. Ini adalah (dari terbaik sampai terburuk) - o Problem Solving atau Konfrontasi (melihat fakta, menganalisis mereka dan mencari solusi).Ini adalah contoh situasi win-win. o Mengorbankan (Temukan rute tengah). Ini adalah contoh situasi longgar- longgar. o Penarikan atau Penghindaran o Smoothing (Tekankan perjanjian) o Memaksa (Lakukan cara saya). Ini adalah contoh situasi win-loose. 9. Proses pemecahan masalah memiliki langkah-langkah ini - o Menentukan penyebab masalah o Menganalisis masalah o Mengidentifikasi solusi o Melaksanakan keputusan o Tinjau keputusan, dan mengkonfirmasi bahwa masalah terpecahkan. 10. Proses tim mengelola proyek adalah proses kinerja anggota tim pelacakan dan mengelola isu-isu dalam tim.
  96. 96. P r o j e c t Human R e s o u r c e M a n a g e m e n t 12. Mengelola proses tim proyek Input Alat dan Teknik Output Tugas staf proyek Pengamatan dan percakapan Perusahaan faktor lingkungan update Rencana pengelolaan proyek Penilaian kinerja proyek Update aset proses organisasi Aset kinerja tim Manajemen konflik Perubahan permintaan Laporan Kinerja Log Issue Update rencana pengelolaan proyek Aset proses organisasi Keterampilan interpersonal 13. War room adalah teknik untuk membangun tim. Sebagai bagian dari tim proyek ini bertemu dalam satu ruangan. Ini membantu untuk menciptakan identitas proyek. 14. Halo Effect adalah asumsi bahwa karena orang tersebut baik pada teknologi, ia akan baik sebagai manajer proyek.
  97. 97. P r o j e c t Human R e s o u r c e M a n a g e m e n t 15. Ada banyak teori organisasi. Beberapa yang utamaadalah - Teori Harapan, McGregory Teori, Teori Herzberg, Maslow Hirarki kebutuhan. o Harapan Teori - Orang-orang menerima untuk dihargai atas usaha mereka. Ini adalah faktor motivasi. Orang-orang dimasukkan ke dalam upaya lebih karena mereka menerima untuk dihargai atas usaha mereka. o McGregory Teori X dan Y - Ada dua jenis karyawan. Karyawan tipe X harus selalu diawasi. Mereka tidak bisa dipercaya dan harus dikelola mikro. Karyawan tipe Y, di sisi lain, memiliki motivasi diri.Mereka bisa bekerja secara independen. o Herzberg Teori - faktor Hygiene (gaji, kebersihan dll) jika tidak hadir dapat menghancurkan motivasi. Namun kebersihan yang baik saja tidak meningkatkan motivasi. Apa yang memotivasi orang adalah pekerjaan itu sendiri. Faktor motivasi bagi karyawan termasuk tanggung jawab, aktualisasi diri, pertumbuhan, pengakuan dll o Hirarki kebutuhan Maslow - ada berbagai tingkat kebutuhan bagi karyawan. Ketika tingkat yang lebih rendah terpenuhi, karyawan berusaha untuk mencapai tingkat yang lebih tinggi. Kepuasan maksimum dicapai saat karyawan mencapai tingkat tertinggi kepuasan - pemenuhan diri. Tingkat ini kebutuhan dari yang tertinggi sampai terendah adalah - 1. Pemenuhan diri 2. Penghargaan 3. Sosial 4. Keselamatan 5. Fisiologi
  98. 98. Next topic: Project Communication Management Thank You
  99. 99. Overview Project Management Body of Knowledge (PMBOK © Guide 2013 Edition) Project Communication Management
  100. 100. KnowledgeArea Process Initiating Planning Executing Monitoring& Contol Closing Communication Plan Communication DistributeInformation ManageStakeholders- Expectations Report Performance Enterphase/ Startproject Exit phase/ Endproject Initiating Processes Closing Processes Executing Processes Monitoring & Controlling Processes Planning Processes 10. Project Communication Management
  101. 101. Project Communication Management
  102. 102. Project Communication Management Bab ini mencakup konsep-konsep kunci yang berkaitan dengan Komunikasi Manajemen Proyek. 1. Area pengetahuan Manajemen Komunikasi Proyek terdiri dari proses berikut - Proses Manajemen Komunikasi Proses Proses Kelompok Deliverables Kunci Manajemen Komunikasi Rencana Perencanaan Rencana Pengelolaan Komunikasi Mengelola Komunikasi Pelaksana Proses Organisasi update aset Kontrol Komunikasi Pemantauan dan Pengendalian Laporan Kinerja 2. Rencana Manajemen Komunikasi mendefinisikan bagaimana dan kapan berbagai pemangku kepentingan menerima informasi, dan berkomunikasi satu sama lain. Memo, email adalah contoh komunikasi non-formal.
  103. 103. Project Communication Management 3. Jumlah saluran komunikasi antar stakeholder n adalah n (n-1) / 2. Jadi, jika ada sepuluh stakeholder dalam proyek, ada 45 saluran komunikasi. 4. Proses Rencana Komunikasi melibatkan menentukan apa jenis informasi harus dibagi dengan yang proyek stakeholder. Hal ini didokumentasikan dalam rencana pengelolaan komunikasi. Juga didokumentasikan adalah bagaimana dan kapan komunikasi perlu untuk dibagikan dengan para pemangku kepentingan. 5. Proses Rencana Komunikasi Input Alat & Teknik Output Stakeholder mendaftar Analisis kebutuhan komunikasi Rencana pengelolaan komunikasi Strategi manajemen Stakeholder Teknologi komunikasi Update dokumen proyek Faktor lingkungan perusahaan Model Komunikasi Aset proses organisasi Metode komunikasi
  104. 104. Project Communication Management 6. Sepanjang durasi proyek, informasi yang dibagi dengan para pemangku kepentingan seperti yang direncanakan. Ini berbagi informasi merupakan bagian dari Mengelola proses komunikasi. Mengelola Komunikasi Input Alat & Teknik Output Rencana pengelolaan proyek Metode komunikasi Update aset proses organisasi Laporan Kinerja Alat penyebaran informasi Aset proses organisasi 7. Proses Kontrol Komunikasi melibatkan berbagi laporan status proyek dan pengukuran dengan para pemangku kepentingan yang tepat. Kontrol Proses Komunikasi Input Alat & Teknik Output Rencana Manajemen Proyek Analisis varians Laporan Kinerja Informasi kinerja kerja Peramalan metode Update aset proses organisasi Pengukuran kinerja kerja Metode komunikasi Perubahan permintaan Perkiraan anggaran Sistem pelaporan Aset proses organisasi
  105. 105. Thank You >>N e x t topic: 11- P r o j e c t Risk M a n a g e m e n t
  106. 106. Overview Project Management Body of Knowledge (PMBOK © Guide 2013 Edition) Project Risk Management
  107. 107. Knowledge Area Process Initiating Planning Executing Monitoring&Contol Closing Risk PlanRiskManagement IdentifyRisk PerformQualitativeRiskAnalysis PerformQuantitativeRiskAnalysis PlanRiskResponse MonitorandControl Risks Enterphase/ Startproject Exit phase/ Endproject Initiating Processes Closing Processes Executing Processes Monitoring & Controlling Processes Planning Processes P r o j e c t Risk M a n a g e m e n t
  108. 108. Project Risk Management
  109. 109. Project Risk Management Bab ini mencakup konsep-konsep kunci yang berkaitan dengan Proyek Manajemen Risiko. 1. Proses Manajemen Risiko Proses Tahap Proyek Deliverables Kunci Manajemen Risiko Rencana Perencanaan Rencana Manajemen Risiko IdentifikasiResiko Perencanaan Daftar risiko Lakukan Analisis Risiko Kualitatif Perencanaan Update daftar risiko Lakukan Analisis Risiko Kuantitatif Perencanaan Update daftar risiko Tanggapan Risiko Rencana Perencanaan Keputusan kontrak risiko terkait Memantau dan Pengendalian Risiko Pemantauan dan Pengendalian Update daftar risiko 2. Sebuah risiko proyek merupakan sumber potensial dari penyimpangan dari rencana proyek. Risiko proyek dapat memiliki dampak negatif atau positif pada proyek. Risiko proyek yang negatif disebut ancaman. Risiko proyek yang positif disebut peluang.
  110. 110. Project Risk Management 3. Responses to ancaman meliputi - o Mengurangi kemungkinan risiko o Menyusun rencana kontingensi o Pasif menerima konsekuensi. o Mentransfer risiko Asuransi adalah contoh dari mentransfer risiko. 4. Risiko non-kritis harus didokumentasikan. Mereka harus ditinjau kembali dan ditinjau secara teratur. Risiko yang diidentifikasi dalam semua tahap. 5. Work-around mengacu pada bagaimana menangani risiko yang telah terjadi tetapi bukan bagian dari rencana respons risiko. Hal ini terjadi dalam pemantauan risiko dan fase kontrol.
  111. 111. Project Risk Management 6. TeknikDelphiinipalingseringdigunakanuntukmemperolehpendapatahlitentang masalahteknis.Halini dapatdigunakanuntukmendapatkanmasukanmengenai Lingkup,EstimasiatauRisiko.BeberapakarakteristikdariteknikDelphi - o Paraahliidentitasanonim.Merekatidakdiruangyang sama. o PM mencobauntukmembangunkonsensusdiantarapara ahli.
  112. 112. >>N e x t topic: 11- P r o j e c t P r o c u r e m e n t M a n a g e m e n t Thank You
  113. 113. Overview Project Management Body of Knowledge (PMBOK © Guide 2013 Edition) Project Procurement Management
  114. 114. KnowledgeArea Process Initiating Planning Executing Monitoring&Contol Closing Procurement PlanProcurement Management ConductProcurement Control Procurements CloseProcurement Enterphase/ Startproject Exit phase/ Endproject Initiating Processes Closing Processes Executing Processes Monitoring & Controlling Processes Planning Processes 12. P r o j e c t P r o c u r e m e n t M a n a g e m e n t
  115. 115. Project ProcurementManagement
  116. 116. Project ProcurementManagement Bab ini mencakup konsep-konsep kunci yang berkaitan dengan Proyek Manajemen Pengadaan. 1. Manajemen Pengadaan melibatkan mendapatkan pekerjaan yang dilakukan oleh orang di luar tim proyek. Manajemen Pengadaan Proyek meliputi administrasi kontrak dan proses perubahan kontrol untuk mengelola kontrak atau pesanan pembelian. Area pengetahuan Manajemen Pengadaan Proyek terdiri dari proses berikut – Proses Manajemen Pengadaan Proses Tahap Proyek Deliverables Kunci Rencana Pengelolaan Pengadaan Perencanaan Rencana Manajemen Pengadaan Perilaku Pengadaan Eksekusi Penjual yang dipilih, penghargaan kontrak Pengadaan Kontrol Pengadaan Pemantauan dan Pengendalian Perubahan permintaan Tutup Pengadaan Penutupan Pengadaan Tertutup 2. Proses Rencana Pengadaan melibatkan membangun vs membeli keputusan.
  117. 117. Project ProcurementManagement 3. Proses Manajemen Rencana Pengadaan Input Alat danTeknik Output Lingkup dasar Make-or-buy analisis Rencana pengelolaan Pengadaan Persyaratan dokumentasi Penilaian ahli Laporan pengadaan pekerjaan Teaming perjanjian JenisKontrak Make-or-buy keputusan Daftar risiko Dokumen pengadaan Keputusan kontrak-risiko terkait Kriteria seleksi Sumber Kebutuhan sumber daya Activity Perubahan permintaan Jadwal proyek Perkiraan biaya kegiatan Kinerja biaya awal Faktor lingkungan perusahaan Aset proses organisasi 4. Sebuah kontrak adalah perjanjian formal. Ini adalah dokumen hukum menanti untuk kedua penjual dan pembeli. Perubahan kontrak harus dilakukan secara tertulis dan secara resmi dikendalikan. Kebanyakan Pemerintah kembali semua kontrak dengan menyediakan sistem pengadilan.
  118. 118. Project ProcurementManagement 5. Proses Etik Pengadaan melibatkan menerima tanggapan penjual, memilih penjual, dan pemberian kontrak. Selama proses ini tawaran atau proposal dari penjual dievaluasi, dan satu atau lebih penjual yang dipilih untuk melaksanakan pekerjaan. 6. Melakukan proses Pengadaan Input Alat dan Teknik Output Rencana Manajemen Proyek Konferensi Penawar Penjual yang dipilih Dokumen pengadaan Teknik evaluasi Proposal Pengadaan penghargaan kontrak Kriteria sumber Seleksi Perkiraan independen Kalender sumber daya Daftar penjual Berkualitas Penilaian ahli Perubahan permintaan Proposal Penjual Pengiklanan Update rencana pengelolaan proyek Dokumen proyek Pencarian Internet Update dokumen proyek Make-or-buy keputusan Negosiasi pengadaan Teaming perjanjian Aset proses organisasi
  119. 119. Project ProcurementManagement 7. Sole Source mengacu pada kondisi pasar di mana hanya ada satu penjual yang memenuhi syarat ada di pasar. Sumber Tunggal mengacu pada kondisi pasar di mana perusahaan lebih memilih untuk kontrak dengan hanya satu penjual. Oligopoli mengacu pada kondisi pasar di mana sangat sedikit penjual yang ada, dan aksi satu penjual akan berdampak pada hadiah penjual lainnya. 8. Konferensi penawar adalah pertemuan antara pembeli dan penjual sebelum tawaran tersebut diajukan. Konferensi ini digunakan oleh pembeli untuk memberikan informasi yang konsisten untuk semua penjual.
  120. 120. Project ProcurementManagement 9. Proses Pengendalian Pengadaan melibatkan hubungan pengadaan mengelola dan memastikan kinerja penjual memenuhi persyaratan pengadaan. Proses Pengadaan kontrol Input Alat danTeknik Output Dokumen pengadaan Sistem kontrol perubahan Kontrak Dokumentasi Pengadaan Rencana pengelolaan proyek Ulasan kinerja pengadaan Update aset organisasi Kontrak Inspeksi dan audit Perubahan permintaan Laporan Kinerja Pelaporan kinerja Update rencana pengelolaan proyek Permintaan perubahan disetujui Sistem Pembayaran Informasi kinerja kerja Administrasi klaim Sistem manajemen arsip
  121. 121. Project ProcurementManagement 10. Kontrak dapat digunakan sebagai alat manajemen risiko, seperti dalam mentransfer risiko. 11. Persetujuan Sentralisasi mengacu pada kantor kontraktor terpisah yang menangani kontrak untuk semua proyek. Dalam Persetujuan De-sentralisasi administrator kontrak diberikan untuk setiap proyek. 12. Force majeure adalah acara yang kuat dan tak terduga, seperti angin topan atau bencana lainnya. 13. informasi kontraktual adalah merupakan rahasia antara pelanggan dan vendor. 14. Proses Tutup Pengadaan melibatkan menyelesaikan setiap pengadaan. Proses ini melibatkan verifikasi bahwa semua pekerjaan yang direncanakan sesuai kontrak telah selesai. Tutup proses Pengadaan Input Alat dan Teknik Output Rencana pengelolaan proyek Audit pengadaan Pengadaan Tertutup Dokumentasi Pengadaan Pemukiman Negosiasi Update proses organisasi Sistem manajemen arsip
  122. 122. >>N e x t topic: 13- P r o j e c t S t a k e h o l d e r M a n a g e m e n t
  123. 123. Overview Project Management Body of Knowledge (PMBOK © Guide 2013 Edition) Project Satkeholder Management
  124. 124. Project StakeholderManagement Manajemen pemangku kepentingan proyek terdiri dari proses yang diperlukan untuk mengidentifikasi orang-orang, kelompok, dan organisasi yang dapat mempengaruhi atau dipengaruhi oleh proyek. Ini melibatkan menganalisis harapan pemangku kepentingan dalam menyusun strategi manajemen untuk secara efektif melibatkan para pemangku kepentingan dalam keputusan proyek dan pelaksanaan proyek.Manajemen Stakeholder juga berfokus pada komunikasi terus-menerus dengan para pemangku kepentingan, mengelola konflik, dan mempromosikan keterlibatan pemangku kepentingan yang tepat dalam keputusan dan kegiatan proyek. Berikut proses dan tujuan utama dari manajemen pemangku kepentingan proyek didefinisikan di bawah ini:  Identifikasi Stakeholder. Tujuan: daftarpemangku kepentingan.  Rencana Manajemen Stakeholder. Tujuan: Rencana pengelolaan stakeholder.  Mengelola Stakeholder Engagement. Tujuan: daftar isue/masalah, permintaan perubahan.  Keterlibatan Kontrol Stakeholder. Tujuan: informasi kinerja kerja, permintaan perubahan.
  125. 125. Project StakeholderManagement Keluaran tingkat tinggi pada Project Stakeholder Manajemen adalah: Memulai Perencanaan Pelaksana Pemantauan dan Pengendalian Penutupan Dafar Stakeholder Rencana Manajemen Stakeholder Daftar Stakeholder CR Info Kinerja Kerja CR Manajemen pemangku kepentingan proyek berfokus pada proses yang diperlukan untuk mengidentifikasi orang-orang, kelompok, atau organisasi yang dapat baik dampak atau dipengaruhi oleh proyek. Beberapa dari proses ini adalah sebagai berikut:  Menganalisis harapan pemangku kepentingan dan dampaknya terhadap proyek tersebut.  Menyusun strategi pengelolaan yang tepat untuk melibatkan para pemangku kepentingan.  Pelaksanaan komunikasi terus-menerus dengan para pemangku kepentingan untuk memahami kebutuhan dan harapan.  Membina keterlibatan pemangku kepentingan dalam proyek untuk keputusan dan kegiatan.  Berfokus pada kepuasan pemangku kepentingan sebagai tujuan proyek kunci.
  126. 126. Project StakeholderManagement Identifikasi Stakeholders adalah proses mengidentifikasi semua individu atau organisasi yang bisa positif atau negatif dampak proyek, dan mendokumentasikan mereka pengaruh, dampak, bunga, dan keterlibatan pada keberhasilan proyek. Ini adalah wilayah kunci dalam proses manajemen proyek, karena banyak proyek gagal karena kurangnya identifikasi stakeholder lengkap. Sebagian besar proyek akan memiliki sejumlah besar pemangku kepentingan, dan itu adalah tugas seorang manajer proyek untuk mengidentifikasi para pemangku kepentingan dan memahami dampak dari proyek pada area bisnis tertentu mereka. Dalam hal ini, pekerjaan manajer proyek sebesar fungsi manajemen hubungan. Output utama dari proses ini adalah untuk menciptakan sebuah daftar pemangku kepentingan yang mengidentifikasi dengan sangat rinci, segala sesuatu tentang stakeholder pada proyek.
  127. 127. Project StakeholderManagement Sebagai bagian dari proses Pengelolaan Stakeholder Expectations, manajer proyek bekerja dengan para pemangku kepentingan, memahami dan membahas kebutuhan dan harapan mereka. Mengelola Stakeholder Expectations Proses Input Alat & Teknik Output Daftar Stakeholder Metode komunikasi Update aset proses organisasi Strategi manajemen Stakeholder Keterampilan interpersonal Perubahan permintaan Rencana pengelolaan proyek Keterampilan manajemen Update rencana pengelolaan proyek Log Issue Update dokumen proyek Ubah log Aset proses organisasi
  128. 128. 18/08/2015 130

×