SlideShare a Scribd company logo
1 of 48
Genetic predisposition to
papillary thyroid cancer
Albert de la Chapelle
The Ohio State University
Fagin and Wells NEJM, 2016
Heritability of selected cancers
Thyroid 8.48 12.42
Testis 8.57 8.5
Multiple myeloma 4.29 5.62
Prostate 2.21 9.41 0.42
Colorectum 2.54 4.41 0.35
Breast 1.83 2.01 0.27
Lung 2.55 3.16 0.26
All cancers 2.15 3.53
Site Family risk ratio
Utah1 Sweden2
Twin study3
(proportion of
variance)
1. Goldgar et al. 1994 2. Dong and Hemminki 2001 3. Lichtenstein et al. 2000
Adapted from Risch 2001
Odds ratio (OR)
Odds ratio = likelihood of acquiring the
phenotype (e.g. PTC) if marker
present relative to when it is absent
OR >1 is “predisposing”
OR <1 is “protective”
In the last few years the term odds ratio
has begun to be called “effect size”
OR and effect size are equivalent to
“penetrance”
Searching for predisposing
genes
• Loss of heterozygosity
• Association studies
• Next generation sequencing
• Linkage analysis in families
Linkage in PTC
Literature
• Between 1997 and 2006 at least 5
loci were proposed: 1p21, 2q21,
8p23, 14q32, 19p13
• Despite vigorous efforts no genes
have been found
• These data suggest genetic
heterogeneity, multigenic and
multifactorial inheritance, probably
low penetrance.
Main reason for failure of linkage
analysis in PTC is
Overdiagnosis (?)
Unfortunately, the Next Generation
Sequencing suffers from the same problem.
• Definition of overdiagnosis
“Diagnosis of those that would not, if left alone, result in
symptoms or death”
• “Overdiagnosis accounting for thyroid cancer in women
South Korea 90%
USA, Italy, France 70-80%
Japan, Nordic countries, UK 50%”
• “There is no evidence of new risk factors or increased
exposure”
NEJM 2016
Ahn et al. NEJM, 2014
M
M M
M M
WT
WT WT
WT WT WT WT WTWT
LOD score: 2.05
M
M M
M M
WT
WT WT
WT WT WT WT WTWT
LOD score: 0.79
Summary of candidate
genes found by linkage
OSU
Chromosome Gene description No. families Ref
8q24 A lncRNA inside the TG gene 7 1
12q14 SRGAP1 4 2
4q32 An enhancer of unknown function 1 3
1. He et al. Cancer Res 2009
2. He et al. JCEM 2013
3. He et al. PLoS One 2013
He et al. JCEM 2013
Whole genome linkage analysis of 38 PTC families
Plot of the genome-wide linkage scan with posterior PPL from 38 families.
He et al. JCEM 2013 (V. Vieland)
SRGAP1, Slit-Robo Rho GTPase
activating protein 1 gene
• Located in 12q14; found by linkage
• Different missense mutations segregate with
PTC in 3 families
• Missense mutations occur in sporadic cases
and controls (OR 1.21, p=0.0008)
• Missense variants impair the inactivation of
CDC42, a key function
• SRGAP1 is a candidate gene for PTC
susceptibility and has low-medium penetrance
A>C enhancer mutation in gene desert found by targeted deep sequencing
He et al. PLoS One 2013
Long-range enhancer
mutation 4q32 A>C
• Enhancer element is highly conserved
• ChIP assay confirms enrichment of
enhancer marks, e.g. H3K4me1
• Enhancer binds TFs POU2F and YY1
• Risk allele (C) greatly impairs TF binding
• Enhancer RNA is greatly downregulated
in thyroid tumors
Enhancer A>C mutation in 4q32
is ultra rare
• Found in 11 affected individuals of one
large non-medullary thyroid carcinoma
family
• Not found in 38 other families
• Not found in 2676 sporadic cases
• Not found in 2470 controls
• Target genes not yet found
This suggests an ultra-rare, high-
penetrance mutation
Enhancer mutation in 4q32
Counseling
• Initial pedigree had 11 affected individuals
• Extensive counseling has resulted in much
larger pedigree
• Testing for mutation: positive 34/68
negative 34/68
• Sex ratio in mut. positive individuals:
males n=17
females n=17
Hypothesis
Most of the heritability in PTC is due to
(common?) low-penetrance genes
The way of approaching these is….
Genome-wide association study
GWAS
Genome-wide association studies, GWAS
• Principle: search for marker that is more common in cases
than in controls
• Discovery test: type many (e.g. 1 million) SNPs in e.g. 1000
cases, 1000 controls
• Validation test: type top SNPs (e.g. 50) in e.g. a further 2000
cases, 2000 controls
• Replication test: type top SNPs (e.g. 5) in further cases and
controls from different populations
• Because of multiple testing, apply rigorous significance
standards (e.g. p 10-8)
GWAS-generated loci for PTC
Summary, first two GWAS
• 9q22 (OR 1.8) intergenic, apparently related to one or two
lincRNA genes (data shown). FOXE1 nearby
• 14q13 (OR 1.37) intergenic, risk allele affects thyroid
specific lincRNA (data shown). NKX2-1 nearby
• 2q35 (OR 1.34) in DIRC3 gene
• 8p12 (OR 1.36) in first intron of neuroregulin (NRG1) gene.
Risk allele lowers gene expression
• 14q13 (OR 2.09) intergenic, close to but independent of
first 14q13 locus
Putative lincRNA transcripts in 9q22
PTCSC = papillary thyroid cancer susceptibility candidate
unspliced transcript of PTCSC2 (>60 Kb) spans the genomic region
containing SNP rs965513.
rs965513
Shared haplotype
rs1877431
rs10983700
rs1561960
rs7871887
rs1867277
FOXE1
PTCSC2-
unspliced
PTCSC2-
spliced
Three enhancers and 4 functional
variants in a ~33 kb block in 9q22
He et al. PNAS 2015
89 kb 247 kb
Two GWAS SNPs in Chromosome 14q13.3
PTCSC3
rs944289
MBIP
rs116909374
SFTA3 NKX2-1
30 kb
lincRNA (TCONS_00022711)
PTCSC3
GAPDH
PTCSC3
GAPDH
PTCSC3 in 14q13 locus
0.20.40.60.8
2^-(DeltaCt)
Normal, NKX2.1 Vs rs944289
CC
n=11
CT
n=33
TT
n=28
0.20.40.60.8
2^-(DeltaCt)
Tumor, NKX2.1 Vs rs944289
CC
n=11
CT
n=31
TT
n=29
rs944289[T]
Adjacent unaffected Tumor
CC
n=11
CT
n=31
TT
n=29
CC
n=11
CT
n=31
TT
n=29
2^-deltaCt
2^-deltaCt
The risk allele [T] of the SNP increases the
expression of NKX2-1 (TTF1) in thyroid tissue
Kruskal test p-value =0.0899
Pairwise Wilcoxon test,
TT vs CC, p value= 0.14
TT vs CT, p value= 0.046
Kruskal test p-value =0.0200
Pairwise Wilcoxon test,
TT vs CC, p value= 0.074
TT vs CT, p value= 0.0074
PTC: Examples of clinical association
at the 14q13 locus
Data from genotyping 1216 cases and 1416 controls
• rs965513 associates with larger tumor size (p=0.025) and
extrathyroidal expansion (OR=1.29, p=0.045)
• Rs2439302 associates with lymph node metastasis (OR 1.24,
p=0.016) and multifocality of the tumor (OR 1.24, p=0.012)
Much more to come…
Jendrzejewski et al. Thyroid 2016
Predictive power of GWAS loci
Towards the development of a risk
panel
• 5 loci described so far
• ORs range from ~1.4 to ~2.1
• Are these ratios additive?
2 large cohorts of cases and controls
genotyped for the 5 loci
Ohio 747 cases 1047controls;
Warsaw 1795 cases 2090 controls
Additive risks sought
Liyanarachchi et al. Thyroid 2013
Cumulative odds ratios relative to
number of risk alleles for 5 GWAS SNPs
Liyanarachchi et al. Thyroid 2013
Third GWAS deCODE + OSU
Paper submitted, Gudmundsson et al. 2016
•Previous 5 loci confirmed
•5 new loci detected
•Involvement of coding genes observed
Next generation sequencing (NGS)
* Whole exome sequencing WES
* Whole genome sequencing WGS
• In principle predisposing genes can be found in
individual patients by whole genome sequencing and
perfect bioinformatics
• In practice this does not work
• Power of resolution can be improved by studying
families searching for variants shared by affecteds
• When families are reasonably large linkage can help
focus search for relevant variants
• Discrimination power can be enhanced by
haplotyping
• NB overdiagnosis of PTC
WES of PTC
• Our first NGS experiment
• Study 7 PTC families with > 4
affected
• Do WES on 2 affected/family
• Present results:
Positive finding in 2
Whole exome sequencing in 7 PTC families
*
*
*
*
* * * *
* *
* * *
Whole Exome Sequencing
* Genotyping used for Linkage Analysis
**
*
* * * *
*
*
*
* *
*
*
Filtering principles and results
Conditions and filtering No. of variants
• Variants detected ~1 million/individual
• Quality filtering ~200,000/individual
• Elimination of common variants (>0.01) ~10,000/individual
• Variant shared by the 2 affecteds ~2000/family
• Not found in other than one family ~400/family
• Deleterious by nature of variant & conservation ~100/family
• Expressed in thyroid ~40/family
Akagi, Symer et al.
How to filter the remaining
candidates (n=40)
• Validate mutation by Sanger
• Literature (cancer involvement?)
• Databases (same mutation seen?)
• Cosegregation in the family
• Genotyping results from deCODE
• Linkage (peak or valley)
• Haplotype sharing
• Population occurrence
Segregation of SRRM2 c.1037 (S346F) variant in Family 7
Haplotype sharing
Typing of PTC cases and controls:
7/1170 sporadic cases
0/1404 controls
OR = 8.14; p-value = 0.049
0/138 familial cases
Haplotype sharing:
a good filter to eliminate candidate variants
(Final 21 candidates from Family 7)
Linkage analysis of Family 7
SRRM2
(chr 16)
SRm300 aka SRRM2 Gene (Serine/arginine repetitive matrix protein 2)
NM_016333: 9379 nt in 15 exons
Ser346Phe
S346F
1
human 339 KDKDKKEKSATRPSPSPERSSTGPEPPAPTPLLAERHGGSPQPLAT 383
mouse 241 KD--KKEKSAVRPSPSPERSSTGPELPAPTPLLVEQHVDSPRPLAA 285
chimpanzee 339 KDKDKKEKSATRPSPSPERSSTGPEPPAPTPLLAERHGGSPQPLAT 383
pig 339 KGKDKKEKSAVRSSPSPERSSTGPEPPAPTPLLAEQHGGSPQPLAT 383
dog 339 KDKE-KEKSGIRPSPSPERSSTGPEPPAPTPLLAEQHGGSPQPLAT 381
cat 263 KDKD-KEKSAIRPSPSPERSSAGPEPPAPTPLLAEQHGGSPQPLAT 307
cattle 338 KD--KKEKSAVRPSPSPERSNTGPEPPAPTLLLAEQHGGSPQPLAT 381
sperm whale 355 KDKDKKEKSAVQPSPSPERSSTGPELPAPTPLLAEQYGGSPQPLAT 400
2752
RSD-1 RSD-2
Protein: 2752 aa  300 kDa
Heat map of 1642 alternative splicing
events
RNA-Seq data: alternatively spliced transcripts in the cases
were differentially expressed when compared to controls
PSI: the ratio of the “included”
expression level vs. the sum of both
spliced isoforms.
Yellow: higher PSI.
Blue: lower PSI.
Main problems
• Only coding DNA typed
• Unexpectedly common mutation (>1%; >3%
etc.) would be filtered out
• Only mutations classified as “pathogenic”
are considered
121781
$ $ $
144961
150004
$
$
$
$
128705
$ $
$
$
$ $
$
*
**
$
$
$
*
**
3 6
$
$ $
89281 75700
69238 20778
*
PTC
Melanoma
** PTC & melanoma
Goiter or nodules
Other benign thyroid disease
KEY
Spherocytosis
$, Whole genome sequence
Other malignancy
$ $ $
$$
$ $ $ $
$
Whole genome sequencing performed in 8 families
FILTERING
Whole genome sequencing in PTC families
Summary of results in 8 families
• Filtering excluded everything except coding variants
of genes expressed in thyroid tissue and with
predicted pathogenicity
• The median number of remaining candidate genes
per families was 27 (range 14-83)
• Efforts to identify the correct gene(s) are underway
So What?
Consequences of gene discoveries
• Improved molecular insight; pathways?
Yes but slow
• Diagnosis?
Yes but mainly in families
• Clinical stratification?
Promising but so far modest impact

More Related Content

What's hot

Update on Systemic Therapy for Metastatic Pancreas Adenocarcinoma
Update on Systemic Therapy for Metastatic Pancreas AdenocarcinomaUpdate on Systemic Therapy for Metastatic Pancreas Adenocarcinoma
Update on Systemic Therapy for Metastatic Pancreas AdenocarcinomaOSUCCC - James
 
Survivorship Issues Genetics 2016
Survivorship Issues Genetics 2016Survivorship Issues Genetics 2016
Survivorship Issues Genetics 2016OSUCCC - James
 
Highlights from asco gu 2017
Highlights from asco gu 2017   Highlights from asco gu 2017
Highlights from asco gu 2017 Mohamed Abdulla
 
Familial predisposition for colorectal cancers: Who to screen?
Familial predisposition for colorectal cancers: Who to screen?Familial predisposition for colorectal cancers: Who to screen?
Familial predisposition for colorectal cancers: Who to screen?OSUCCC - James
 
MANAGEMENTOF METASTATIC OR ADVANCED GASTRIC CANCER : FIRST LINE OPTIONS
MANAGEMENTOF METASTATIC OR ADVANCED GASTRIC CANCER : FIRST LINE OPTIONSMANAGEMENTOF METASTATIC OR ADVANCED GASTRIC CANCER : FIRST LINE OPTIONS
MANAGEMENTOF METASTATIC OR ADVANCED GASTRIC CANCER : FIRST LINE OPTIONSMohamed Abdulla
 
The grey zone in prostate cancer management
The grey zone in prostate cancer managementThe grey zone in prostate cancer management
The grey zone in prostate cancer managementMohamed Abdulla
 
Astellas meeting, crpc- what we have in 2019
Astellas   meeting, crpc- what we have in 2019Astellas   meeting, crpc- what we have in 2019
Astellas meeting, crpc- what we have in 2019Mohamed Abdulla
 
Ohio State's 2016 ASH Review T-cell Disorders
Ohio State's 2016 ASH Review T-cell DisordersOhio State's 2016 ASH Review T-cell Disorders
Ohio State's 2016 ASH Review T-cell DisordersOSUCCC - James
 
Prostate cancer nemrock 2015 sanofi
Prostate cancer nemrock 2015   sanofiProstate cancer nemrock 2015   sanofi
Prostate cancer nemrock 2015 sanofiMohamed Abdulla
 
ASCO 2016 Sarcoma Review
ASCO 2016 Sarcoma ReviewASCO 2016 Sarcoma Review
ASCO 2016 Sarcoma ReviewOSUCCC - James
 
Ohio State's 2016 ASH Review - ASH Review 2015 Acute Leukemias and MDS
Ohio State's 2016 ASH Review - ASH Review 2015Acute Leukemias and MDSOhio State's 2016 ASH Review - ASH Review 2015Acute Leukemias and MDS
Ohio State's 2016 ASH Review - ASH Review 2015 Acute Leukemias and MDSOSUCCC - James
 
Ihof heterogenity &amp; personalized treatment crpc 2019
Ihof heterogenity &amp; personalized treatment crpc 2019Ihof heterogenity &amp; personalized treatment crpc 2019
Ihof heterogenity &amp; personalized treatment crpc 2019Mohamed Abdulla
 
Surgery for localised, locally advanced and high risk prostate cancer
Surgery for localised, locally advanced and high risk prostate cancerSurgery for localised, locally advanced and high risk prostate cancer
Surgery for localised, locally advanced and high risk prostate cancerEuropa Uomo EPAD
 
(Ohio State's 2016 ASH Review) ASH 2015 REVIEW – LYMPHOMA ABSTRACTS
(Ohio State's 2016 ASH Review) ASH 2015 REVIEW – LYMPHOMA ABSTRACTS(Ohio State's 2016 ASH Review) ASH 2015 REVIEW – LYMPHOMA ABSTRACTS
(Ohio State's 2016 ASH Review) ASH 2015 REVIEW – LYMPHOMA ABSTRACTSOSUCCC - James
 
Kiow 11 2017 metastatic colon cancer from bench to clinic
Kiow 11 2017 metastatic colon cancer from bench to clinicKiow 11 2017 metastatic colon cancer from bench to clinic
Kiow 11 2017 metastatic colon cancer from bench to clinicMohamed Abdulla
 
Management of Metastatic Cancer Prostate
Management of Metastatic Cancer ProstateManagement of Metastatic Cancer Prostate
Management of Metastatic Cancer ProstateMohamed Abdulla
 
metastatic colorectal cancer; a new chapter in the story
metastatic colorectal cancer; a new chapter in the storymetastatic colorectal cancer; a new chapter in the story
metastatic colorectal cancer; a new chapter in the storyMohamed Abdulla
 
Role of Apalutamide in management of M0 CRPC
Role of Apalutamide in management of M0 CRPCRole of Apalutamide in management of M0 CRPC
Role of Apalutamide in management of M0 CRPCMohamed Abdulla
 

What's hot (20)

Update on Systemic Therapy for Metastatic Pancreas Adenocarcinoma
Update on Systemic Therapy for Metastatic Pancreas AdenocarcinomaUpdate on Systemic Therapy for Metastatic Pancreas Adenocarcinoma
Update on Systemic Therapy for Metastatic Pancreas Adenocarcinoma
 
Survivorship Issues Genetics 2016
Survivorship Issues Genetics 2016Survivorship Issues Genetics 2016
Survivorship Issues Genetics 2016
 
Translating next generation sequencing to practice
Translating next generation sequencing to practiceTranslating next generation sequencing to practice
Translating next generation sequencing to practice
 
Highlights from asco gu 2017
Highlights from asco gu 2017   Highlights from asco gu 2017
Highlights from asco gu 2017
 
Familial predisposition for colorectal cancers: Who to screen?
Familial predisposition for colorectal cancers: Who to screen?Familial predisposition for colorectal cancers: Who to screen?
Familial predisposition for colorectal cancers: Who to screen?
 
MANAGEMENTOF METASTATIC OR ADVANCED GASTRIC CANCER : FIRST LINE OPTIONS
MANAGEMENTOF METASTATIC OR ADVANCED GASTRIC CANCER : FIRST LINE OPTIONSMANAGEMENTOF METASTATIC OR ADVANCED GASTRIC CANCER : FIRST LINE OPTIONS
MANAGEMENTOF METASTATIC OR ADVANCED GASTRIC CANCER : FIRST LINE OPTIONS
 
The grey zone in prostate cancer management
The grey zone in prostate cancer managementThe grey zone in prostate cancer management
The grey zone in prostate cancer management
 
Astellas meeting, crpc- what we have in 2019
Astellas   meeting, crpc- what we have in 2019Astellas   meeting, crpc- what we have in 2019
Astellas meeting, crpc- what we have in 2019
 
Ohio State's 2016 ASH Review T-cell Disorders
Ohio State's 2016 ASH Review T-cell DisordersOhio State's 2016 ASH Review T-cell Disorders
Ohio State's 2016 ASH Review T-cell Disorders
 
Update in oncology
Update in oncologyUpdate in oncology
Update in oncology
 
Prostate cancer nemrock 2015 sanofi
Prostate cancer nemrock 2015   sanofiProstate cancer nemrock 2015   sanofi
Prostate cancer nemrock 2015 sanofi
 
ASCO 2016 Sarcoma Review
ASCO 2016 Sarcoma ReviewASCO 2016 Sarcoma Review
ASCO 2016 Sarcoma Review
 
Ohio State's 2016 ASH Review - ASH Review 2015 Acute Leukemias and MDS
Ohio State's 2016 ASH Review - ASH Review 2015Acute Leukemias and MDSOhio State's 2016 ASH Review - ASH Review 2015Acute Leukemias and MDS
Ohio State's 2016 ASH Review - ASH Review 2015 Acute Leukemias and MDS
 
Ihof heterogenity &amp; personalized treatment crpc 2019
Ihof heterogenity &amp; personalized treatment crpc 2019Ihof heterogenity &amp; personalized treatment crpc 2019
Ihof heterogenity &amp; personalized treatment crpc 2019
 
Surgery for localised, locally advanced and high risk prostate cancer
Surgery for localised, locally advanced and high risk prostate cancerSurgery for localised, locally advanced and high risk prostate cancer
Surgery for localised, locally advanced and high risk prostate cancer
 
(Ohio State's 2016 ASH Review) ASH 2015 REVIEW – LYMPHOMA ABSTRACTS
(Ohio State's 2016 ASH Review) ASH 2015 REVIEW – LYMPHOMA ABSTRACTS(Ohio State's 2016 ASH Review) ASH 2015 REVIEW – LYMPHOMA ABSTRACTS
(Ohio State's 2016 ASH Review) ASH 2015 REVIEW – LYMPHOMA ABSTRACTS
 
Kiow 11 2017 metastatic colon cancer from bench to clinic
Kiow 11 2017 metastatic colon cancer from bench to clinicKiow 11 2017 metastatic colon cancer from bench to clinic
Kiow 11 2017 metastatic colon cancer from bench to clinic
 
Management of Metastatic Cancer Prostate
Management of Metastatic Cancer ProstateManagement of Metastatic Cancer Prostate
Management of Metastatic Cancer Prostate
 
metastatic colorectal cancer; a new chapter in the story
metastatic colorectal cancer; a new chapter in the storymetastatic colorectal cancer; a new chapter in the story
metastatic colorectal cancer; a new chapter in the story
 
Role of Apalutamide in management of M0 CRPC
Role of Apalutamide in management of M0 CRPCRole of Apalutamide in management of M0 CRPC
Role of Apalutamide in management of M0 CRPC
 

Viewers also liked

Explanation slides Multifactorial conditions
Explanation slides Multifactorial conditionsExplanation slides Multifactorial conditions
Explanation slides Multifactorial conditionsmeducationdotnet
 
Multifactorial disorders
Multifactorial disordersMultifactorial disorders
Multifactorial disordersMahin Nwx
 
Differentiated thyroid carcinoma
Differentiated thyroid carcinomaDifferentiated thyroid carcinoma
Differentiated thyroid carcinomaARIJIT8891
 
Malignant thyroid
Malignant thyroidMalignant thyroid
Malignant thyroidAmna Akram
 
Genetically Modified Foods presentation
Genetically Modified Foods presentationGenetically Modified Foods presentation
Genetically Modified Foods presentationGina Peace
 
Application of Microbes in Human Welfare
Application of Microbes in Human WelfareApplication of Microbes in Human Welfare
Application of Microbes in Human WelfarePranavathiyani G
 
Genetic predipositio to cancer
Genetic predipositio to cancerGenetic predipositio to cancer
Genetic predipositio to cancerMahran Alnahmi
 
Clinical features of thyroid malignancy
Clinical features of thyroid malignancyClinical features of thyroid malignancy
Clinical features of thyroid malignancyMohit kadyan
 
A simple method for extraction of fungal genimic dna
A simple method for extraction of fungal genimic dnaA simple method for extraction of fungal genimic dna
A simple method for extraction of fungal genimic dnaCAS0609
 
Journal of Medical Microbiology & Diagnosis
Journal of Medical Microbiology & DiagnosisJournal of Medical Microbiology & Diagnosis
Journal of Medical Microbiology & DiagnosisOMICS International
 
Malignant tumours of thyroid
Malignant tumours of thyroidMalignant tumours of thyroid
Malignant tumours of thyroidkanwalpreet15
 
Nanotechnology and Infectious Diseases
Nanotechnology and Infectious DiseasesNanotechnology and Infectious Diseases
Nanotechnology and Infectious DiseasesInam Khan
 
Carcinoma Of Thyroid Gland
Carcinoma Of Thyroid GlandCarcinoma Of Thyroid Gland
Carcinoma Of Thyroid GlandAhmed Shammasi
 
Chinwe eze seminar presentation
Chinwe eze seminar presentationChinwe eze seminar presentation
Chinwe eze seminar presentationCHARLES EZE
 

Viewers also liked (20)

Explanation slides Multifactorial conditions
Explanation slides Multifactorial conditionsExplanation slides Multifactorial conditions
Explanation slides Multifactorial conditions
 
Multifactorial disorders
Multifactorial disordersMultifactorial disorders
Multifactorial disorders
 
Differentiated thyroid carcinoma
Differentiated thyroid carcinomaDifferentiated thyroid carcinoma
Differentiated thyroid carcinoma
 
Malignant thyroid
Malignant thyroidMalignant thyroid
Malignant thyroid
 
Genetically Modified Foods presentation
Genetically Modified Foods presentationGenetically Modified Foods presentation
Genetically Modified Foods presentation
 
Application of Microbes in Human Welfare
Application of Microbes in Human WelfareApplication of Microbes in Human Welfare
Application of Microbes in Human Welfare
 
Genetic predipositio to cancer
Genetic predipositio to cancerGenetic predipositio to cancer
Genetic predipositio to cancer
 
Clinical features of thyroid malignancy
Clinical features of thyroid malignancyClinical features of thyroid malignancy
Clinical features of thyroid malignancy
 
Thyroid cancers
Thyroid cancersThyroid cancers
Thyroid cancers
 
Bioengineered microbes
Bioengineered microbesBioengineered microbes
Bioengineered microbes
 
A simple method for extraction of fungal genimic dna
A simple method for extraction of fungal genimic dnaA simple method for extraction of fungal genimic dna
A simple method for extraction of fungal genimic dna
 
Journal of Medical Microbiology & Diagnosis
Journal of Medical Microbiology & DiagnosisJournal of Medical Microbiology & Diagnosis
Journal of Medical Microbiology & Diagnosis
 
Malignant tumours of thyroid
Malignant tumours of thyroidMalignant tumours of thyroid
Malignant tumours of thyroid
 
Microsporidiosis
MicrosporidiosisMicrosporidiosis
Microsporidiosis
 
Thyroid neoplasms
Thyroid neoplasmsThyroid neoplasms
Thyroid neoplasms
 
Nanotechnology and Infectious Diseases
Nanotechnology and Infectious DiseasesNanotechnology and Infectious Diseases
Nanotechnology and Infectious Diseases
 
Carcinoma Of Thyroid Gland
Carcinoma Of Thyroid GlandCarcinoma Of Thyroid Gland
Carcinoma Of Thyroid Gland
 
Biology Futures
Biology FuturesBiology Futures
Biology Futures
 
Chinwe eze seminar presentation
Chinwe eze seminar presentationChinwe eze seminar presentation
Chinwe eze seminar presentation
 
thyroid tumor
thyroid tumorthyroid tumor
thyroid tumor
 

Similar to Genetic predisposition to papillary thyroid cancer by Albert de la Chapelle, MD, PhD

Aug2013 Heidi Rehm integrating large scale sequencing into clinical practice
Aug2013 Heidi Rehm integrating large scale sequencing into clinical practiceAug2013 Heidi Rehm integrating large scale sequencing into clinical practice
Aug2013 Heidi Rehm integrating large scale sequencing into clinical practiceGenomeInABottle
 
The emerging picture of host genetic control of susceptibility and outcome in...
The emerging picture of host genetic control of susceptibility and outcome in...The emerging picture of host genetic control of susceptibility and outcome in...
The emerging picture of host genetic control of susceptibility and outcome in...Meningitis Research Foundation
 
Pharmacogenomic Prediction of Antracycline-induced Cardiotoxicity
Pharmacogenomic Prediction of Antracycline-induced CardiotoxicityPharmacogenomic Prediction of Antracycline-induced Cardiotoxicity
Pharmacogenomic Prediction of Antracycline-induced CardiotoxicityGolden Helix
 
Pharmacogenomic Prediction of Antracycline-induced Cardiotoxicity
Pharmacogenomic Prediction of Antracycline-induced CardiotoxicityPharmacogenomic Prediction of Antracycline-induced Cardiotoxicity
Pharmacogenomic Prediction of Antracycline-induced CardiotoxicityGolden Helix Inc
 
Montgomery expression
Montgomery expressionMontgomery expression
Montgomery expressionmorenorossi
 
Bioinformatic Analysis of Synthetic Lethality in Breast Cancer
Bioinformatic Analysis of Synthetic Lethality in Breast CancerBioinformatic Analysis of Synthetic Lethality in Breast Cancer
Bioinformatic Analysis of Synthetic Lethality in Breast CancerTom Kelly
 
Pharmacogenetics
PharmacogeneticsPharmacogenetics
PharmacogeneticsLarry Baum
 
Supporting Genomics in the Practice of Medicine by Heidi Rehm
Supporting Genomics in the Practice of Medicine by Heidi RehmSupporting Genomics in the Practice of Medicine by Heidi Rehm
Supporting Genomics in the Practice of Medicine by Heidi RehmKnome_Inc
 
Day2 145pm Crawford
Day2 145pm CrawfordDay2 145pm Crawford
Day2 145pm CrawfordSean Paul
 
180509 kathiresan mgh cardiology grand rounds to slideshare
180509 kathiresan mgh cardiology grand rounds to slideshare180509 kathiresan mgh cardiology grand rounds to slideshare
180509 kathiresan mgh cardiology grand rounds to slideshareSekarKathiresan
 
Identifying Oncogenic Variants in VarSeq
Identifying Oncogenic Variants in VarSeqIdentifying Oncogenic Variants in VarSeq
Identifying Oncogenic Variants in VarSeqGolden Helix
 
Predicting phenotype from genotype with machine learning
Predicting phenotype from genotype with machine learningPredicting phenotype from genotype with machine learning
Predicting phenotype from genotype with machine learningPatricia Francis-Lyon
 
Src jbbr-20-120 Dr. ihsan edan abdulkareem alsaimary PROFESSOR IN MEDICAL M...
Src jbbr-20-120  Dr. ihsan edan abdulkareem alsaimary  PROFESSOR IN MEDICAL M...Src jbbr-20-120  Dr. ihsan edan abdulkareem alsaimary  PROFESSOR IN MEDICAL M...
Src jbbr-20-120 Dr. ihsan edan abdulkareem alsaimary PROFESSOR IN MEDICAL M...dr.Ihsan alsaimary
 
Gene hunting strategies
Gene hunting strategiesGene hunting strategies
Gene hunting strategiesAshfaq Ahmad
 
Advances and Applications Enabled by Single Cell Technology
Advances and Applications Enabled by Single Cell TechnologyAdvances and Applications Enabled by Single Cell Technology
Advances and Applications Enabled by Single Cell TechnologyQIAGEN
 

Similar to Genetic predisposition to papillary thyroid cancer by Albert de la Chapelle, MD, PhD (20)

Aug2013 Heidi Rehm integrating large scale sequencing into clinical practice
Aug2013 Heidi Rehm integrating large scale sequencing into clinical practiceAug2013 Heidi Rehm integrating large scale sequencing into clinical practice
Aug2013 Heidi Rehm integrating large scale sequencing into clinical practice
 
The emerging picture of host genetic control of susceptibility and outcome in...
The emerging picture of host genetic control of susceptibility and outcome in...The emerging picture of host genetic control of susceptibility and outcome in...
The emerging picture of host genetic control of susceptibility and outcome in...
 
Pharmacogenomic Prediction of Antracycline-induced Cardiotoxicity
Pharmacogenomic Prediction of Antracycline-induced CardiotoxicityPharmacogenomic Prediction of Antracycline-induced Cardiotoxicity
Pharmacogenomic Prediction of Antracycline-induced Cardiotoxicity
 
Pharmacogenomic Prediction of Antracycline-induced Cardiotoxicity
Pharmacogenomic Prediction of Antracycline-induced CardiotoxicityPharmacogenomic Prediction of Antracycline-induced Cardiotoxicity
Pharmacogenomic Prediction of Antracycline-induced Cardiotoxicity
 
2014 07 ismb personalized medicine
2014 07 ismb personalized medicine2014 07 ismb personalized medicine
2014 07 ismb personalized medicine
 
Montgomery expression
Montgomery expressionMontgomery expression
Montgomery expression
 
Dna microarray mehran- u of toronto
Dna microarray  mehran- u of torontoDna microarray  mehran- u of toronto
Dna microarray mehran- u of toronto
 
Bioinformatic Analysis of Synthetic Lethality in Breast Cancer
Bioinformatic Analysis of Synthetic Lethality in Breast CancerBioinformatic Analysis of Synthetic Lethality in Breast Cancer
Bioinformatic Analysis of Synthetic Lethality in Breast Cancer
 
Pharmacogenetics
PharmacogeneticsPharmacogenetics
Pharmacogenetics
 
Supporting Genomics in the Practice of Medicine by Heidi Rehm
Supporting Genomics in the Practice of Medicine by Heidi RehmSupporting Genomics in the Practice of Medicine by Heidi Rehm
Supporting Genomics in the Practice of Medicine by Heidi Rehm
 
Day2 145pm Crawford
Day2 145pm CrawfordDay2 145pm Crawford
Day2 145pm Crawford
 
180509 kathiresan mgh cardiology grand rounds to slideshare
180509 kathiresan mgh cardiology grand rounds to slideshare180509 kathiresan mgh cardiology grand rounds to slideshare
180509 kathiresan mgh cardiology grand rounds to slideshare
 
Identifying Oncogenic Variants in VarSeq
Identifying Oncogenic Variants in VarSeqIdentifying Oncogenic Variants in VarSeq
Identifying Oncogenic Variants in VarSeq
 
Clinical Applications of Next Generation Sequencing
Clinical Applications of Next Generation SequencingClinical Applications of Next Generation Sequencing
Clinical Applications of Next Generation Sequencing
 
Predicting phenotype from genotype with machine learning
Predicting phenotype from genotype with machine learningPredicting phenotype from genotype with machine learning
Predicting phenotype from genotype with machine learning
 
Src jbbr-20-120 Dr. ihsan edan abdulkareem alsaimary PROFESSOR IN MEDICAL M...
Src jbbr-20-120  Dr. ihsan edan abdulkareem alsaimary  PROFESSOR IN MEDICAL M...Src jbbr-20-120  Dr. ihsan edan abdulkareem alsaimary  PROFESSOR IN MEDICAL M...
Src jbbr-20-120 Dr. ihsan edan abdulkareem alsaimary PROFESSOR IN MEDICAL M...
 
Gene hunting strategies
Gene hunting strategiesGene hunting strategies
Gene hunting strategies
 
Advances and Applications Enabled by Single Cell Technology
Advances and Applications Enabled by Single Cell TechnologyAdvances and Applications Enabled by Single Cell Technology
Advances and Applications Enabled by Single Cell Technology
 
155 dna microarray
155 dna microarray155 dna microarray
155 dna microarray
 
155 dna microarray
155 dna microarray155 dna microarray
155 dna microarray
 

More from OSUCCC - James

In Vitro ADMET Considerations for Drug Discovery and Lead Generation
In Vitro ADMET Considerations for Drug Discovery and Lead GenerationIn Vitro ADMET Considerations for Drug Discovery and Lead Generation
In Vitro ADMET Considerations for Drug Discovery and Lead GenerationOSUCCC - James
 
Cell-Based Ion Channel and Cardiac Safety Assays
Cell-Based Ion Channel and Cardiac Safety AssaysCell-Based Ion Channel and Cardiac Safety Assays
Cell-Based Ion Channel and Cardiac Safety AssaysOSUCCC - James
 
In-Vivo Safety - Pre Ind Drug Development
In-Vivo Safety - Pre Ind Drug DevelopmentIn-Vivo Safety - Pre Ind Drug Development
In-Vivo Safety - Pre Ind Drug DevelopmentOSUCCC - James
 
The Path from Chemical Tool to Approvable Drug
The Path from Chemical Tool to Approvable DrugThe Path from Chemical Tool to Approvable Drug
The Path from Chemical Tool to Approvable DrugOSUCCC - James
 
Target Validation / Biochemical and Cellular Assay Development
Target Validation / Biochemical and Cellular Assay Development Target Validation / Biochemical and Cellular Assay Development
Target Validation / Biochemical and Cellular Assay Development OSUCCC - James
 
Intro to Ohio State's Drug Development Bootcamp: Practical Aspects of Positio...
Intro to Ohio State's Drug Development Bootcamp: Practical Aspects of Positio...Intro to Ohio State's Drug Development Bootcamp: Practical Aspects of Positio...
Intro to Ohio State's Drug Development Bootcamp: Practical Aspects of Positio...OSUCCC - James
 
Ohio State's ASH Review 2017 - Blood and Marrow Transplantation
Ohio State's ASH Review 2017 - Blood and Marrow TransplantationOhio State's ASH Review 2017 - Blood and Marrow Transplantation
Ohio State's ASH Review 2017 - Blood and Marrow TransplantationOSUCCC - James
 
Surgical (or Non-Surgical) Managment of Thyroid Cancer in the Era of "Over-Di...
Surgical (or Non-Surgical) Managment of Thyroid Cancer in the Era of "Over-Di...Surgical (or Non-Surgical) Managment of Thyroid Cancer in the Era of "Over-Di...
Surgical (or Non-Surgical) Managment of Thyroid Cancer in the Era of "Over-Di...OSUCCC - James
 
Genetic Syndromes and Thyroid Cancer by Pamela Brock, MS, LGC
Genetic Syndromes and Thyroid Cancer by Pamela Brock, MS, LGCGenetic Syndromes and Thyroid Cancer by Pamela Brock, MS, LGC
Genetic Syndromes and Thyroid Cancer by Pamela Brock, MS, LGCOSUCCC - James
 
ASCO 2016 Review Neuro-oncology
ASCO 2016 Review Neuro-oncologyASCO 2016 Review Neuro-oncology
ASCO 2016 Review Neuro-oncologyOSUCCC - James
 
Melanoma ASCO Review Update 2016
Melanoma ASCO Review Update 2016Melanoma ASCO Review Update 2016
Melanoma ASCO Review Update 2016OSUCCC - James
 
ASCO Review 2016 Colorectal Cancer
ASCO Review 2016 Colorectal CancerASCO Review 2016 Colorectal Cancer
ASCO Review 2016 Colorectal CancerOSUCCC - James
 
ASCO 2016 Breast Cancer Review
ASCO 2016 Breast Cancer ReviewASCO 2016 Breast Cancer Review
ASCO 2016 Breast Cancer ReviewOSUCCC - James
 
ASCO Review 2016 Addressing Health Disparities
ASCO Review 2016 Addressing Health DisparitiesASCO Review 2016 Addressing Health Disparities
ASCO Review 2016 Addressing Health DisparitiesOSUCCC - James
 
Survivorship Care Plans
Survivorship Care PlansSurvivorship Care Plans
Survivorship Care PlansOSUCCC - James
 
Cancer Survivorship Visit
Cancer Survivorship VisitCancer Survivorship Visit
Cancer Survivorship VisitOSUCCC - James
 
Older Adult Survivorship
Older Adult SurvivorshipOlder Adult Survivorship
Older Adult SurvivorshipOSUCCC - James
 
Rehabilitation Issues in Breast Cancer Survivorship
Rehabilitation Issues in Breast Cancer SurvivorshipRehabilitation Issues in Breast Cancer Survivorship
Rehabilitation Issues in Breast Cancer SurvivorshipOSUCCC - James
 

More from OSUCCC - James (20)

In Vitro ADMET Considerations for Drug Discovery and Lead Generation
In Vitro ADMET Considerations for Drug Discovery and Lead GenerationIn Vitro ADMET Considerations for Drug Discovery and Lead Generation
In Vitro ADMET Considerations for Drug Discovery and Lead Generation
 
Cell-Based Ion Channel and Cardiac Safety Assays
Cell-Based Ion Channel and Cardiac Safety AssaysCell-Based Ion Channel and Cardiac Safety Assays
Cell-Based Ion Channel and Cardiac Safety Assays
 
In-Vivo Safety - Pre Ind Drug Development
In-Vivo Safety - Pre Ind Drug DevelopmentIn-Vivo Safety - Pre Ind Drug Development
In-Vivo Safety - Pre Ind Drug Development
 
The Path from Chemical Tool to Approvable Drug
The Path from Chemical Tool to Approvable DrugThe Path from Chemical Tool to Approvable Drug
The Path from Chemical Tool to Approvable Drug
 
Target Validation / Biochemical and Cellular Assay Development
Target Validation / Biochemical and Cellular Assay Development Target Validation / Biochemical and Cellular Assay Development
Target Validation / Biochemical and Cellular Assay Development
 
Intro to Ohio State's Drug Development Bootcamp: Practical Aspects of Positio...
Intro to Ohio State's Drug Development Bootcamp: Practical Aspects of Positio...Intro to Ohio State's Drug Development Bootcamp: Practical Aspects of Positio...
Intro to Ohio State's Drug Development Bootcamp: Practical Aspects of Positio...
 
Ohio State's ASH Review 2017 - Blood and Marrow Transplantation
Ohio State's ASH Review 2017 - Blood and Marrow TransplantationOhio State's ASH Review 2017 - Blood and Marrow Transplantation
Ohio State's ASH Review 2017 - Blood and Marrow Transplantation
 
Surgical (or Non-Surgical) Managment of Thyroid Cancer in the Era of "Over-Di...
Surgical (or Non-Surgical) Managment of Thyroid Cancer in the Era of "Over-Di...Surgical (or Non-Surgical) Managment of Thyroid Cancer in the Era of "Over-Di...
Surgical (or Non-Surgical) Managment of Thyroid Cancer in the Era of "Over-Di...
 
Genetic Syndromes and Thyroid Cancer by Pamela Brock, MS, LGC
Genetic Syndromes and Thyroid Cancer by Pamela Brock, MS, LGCGenetic Syndromes and Thyroid Cancer by Pamela Brock, MS, LGC
Genetic Syndromes and Thyroid Cancer by Pamela Brock, MS, LGC
 
ASCO 2016 Review Neuro-oncology
ASCO 2016 Review Neuro-oncologyASCO 2016 Review Neuro-oncology
ASCO 2016 Review Neuro-oncology
 
Melanoma ASCO Review Update 2016
Melanoma ASCO Review Update 2016Melanoma ASCO Review Update 2016
Melanoma ASCO Review Update 2016
 
ASCO Review 2016 Colorectal Cancer
ASCO Review 2016 Colorectal CancerASCO Review 2016 Colorectal Cancer
ASCO Review 2016 Colorectal Cancer
 
ASCO 2016 Breast Cancer Review
ASCO 2016 Breast Cancer ReviewASCO 2016 Breast Cancer Review
ASCO 2016 Breast Cancer Review
 
ASCO Review 2016 Addressing Health Disparities
ASCO Review 2016 Addressing Health DisparitiesASCO Review 2016 Addressing Health Disparities
ASCO Review 2016 Addressing Health Disparities
 
Asco 2016 GU Review
Asco 2016 GU ReviewAsco 2016 GU Review
Asco 2016 GU Review
 
Survivorship Care Plans
Survivorship Care PlansSurvivorship Care Plans
Survivorship Care Plans
 
Cancer Survivorship Visit
Cancer Survivorship VisitCancer Survivorship Visit
Cancer Survivorship Visit
 
Triage Cancer
Triage CancerTriage Cancer
Triage Cancer
 
Older Adult Survivorship
Older Adult SurvivorshipOlder Adult Survivorship
Older Adult Survivorship
 
Rehabilitation Issues in Breast Cancer Survivorship
Rehabilitation Issues in Breast Cancer SurvivorshipRehabilitation Issues in Breast Cancer Survivorship
Rehabilitation Issues in Breast Cancer Survivorship
 

Recently uploaded

Spellings Wk 3 English CAPS CARES Please Practise
Spellings Wk 3 English CAPS CARES Please PractiseSpellings Wk 3 English CAPS CARES Please Practise
Spellings Wk 3 English CAPS CARES Please PractiseAnaAcapella
 
Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...
Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...
Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...christianmathematics
 
Vishram Singh - Textbook of Anatomy Upper Limb and Thorax.. Volume 1 (1).pdf
Vishram Singh - Textbook of Anatomy  Upper Limb and Thorax.. Volume 1 (1).pdfVishram Singh - Textbook of Anatomy  Upper Limb and Thorax.. Volume 1 (1).pdf
Vishram Singh - Textbook of Anatomy Upper Limb and Thorax.. Volume 1 (1).pdfssuserdda66b
 
General Principles of Intellectual Property: Concepts of Intellectual Proper...
General Principles of Intellectual Property: Concepts of Intellectual  Proper...General Principles of Intellectual Property: Concepts of Intellectual  Proper...
General Principles of Intellectual Property: Concepts of Intellectual Proper...Poonam Aher Patil
 
Fostering Friendships - Enhancing Social Bonds in the Classroom
Fostering Friendships - Enhancing Social Bonds  in the ClassroomFostering Friendships - Enhancing Social Bonds  in the Classroom
Fostering Friendships - Enhancing Social Bonds in the ClassroomPooky Knightsmith
 
How to Create and Manage Wizard in Odoo 17
How to Create and Manage Wizard in Odoo 17How to Create and Manage Wizard in Odoo 17
How to Create and Manage Wizard in Odoo 17Celine George
 
How to Manage Global Discount in Odoo 17 POS
How to Manage Global Discount in Odoo 17 POSHow to Manage Global Discount in Odoo 17 POS
How to Manage Global Discount in Odoo 17 POSCeline George
 
2024-NATIONAL-LEARNING-CAMP-AND-OTHER.pptx
2024-NATIONAL-LEARNING-CAMP-AND-OTHER.pptx2024-NATIONAL-LEARNING-CAMP-AND-OTHER.pptx
2024-NATIONAL-LEARNING-CAMP-AND-OTHER.pptxMaritesTamaniVerdade
 
Food safety_Challenges food safety laboratories_.pdf
Food safety_Challenges food safety laboratories_.pdfFood safety_Challenges food safety laboratories_.pdf
Food safety_Challenges food safety laboratories_.pdfSherif Taha
 
Sociology 101 Demonstration of Learning Exhibit
Sociology 101 Demonstration of Learning ExhibitSociology 101 Demonstration of Learning Exhibit
Sociology 101 Demonstration of Learning Exhibitjbellavia9
 
Unit-IV; Professional Sales Representative (PSR).pptx
Unit-IV; Professional Sales Representative (PSR).pptxUnit-IV; Professional Sales Representative (PSR).pptx
Unit-IV; Professional Sales Representative (PSR).pptxVishalSingh1417
 
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdf
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdfUGC NET Paper 1 Mathematical Reasoning & Aptitude.pdf
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdfNirmal Dwivedi
 
Google Gemini An AI Revolution in Education.pptx
Google Gemini An AI Revolution in Education.pptxGoogle Gemini An AI Revolution in Education.pptx
Google Gemini An AI Revolution in Education.pptxDr. Sarita Anand
 
FSB Advising Checklist - Orientation 2024
FSB Advising Checklist - Orientation 2024FSB Advising Checklist - Orientation 2024
FSB Advising Checklist - Orientation 2024Elizabeth Walsh
 
Graduate Outcomes Presentation Slides - English
Graduate Outcomes Presentation Slides - EnglishGraduate Outcomes Presentation Slides - English
Graduate Outcomes Presentation Slides - Englishneillewis46
 
Single or Multiple melodic lines structure
Single or Multiple melodic lines structureSingle or Multiple melodic lines structure
Single or Multiple melodic lines structuredhanjurrannsibayan2
 
Micro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdfMicro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdfPoh-Sun Goh
 
Unit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptxUnit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptxVishalSingh1417
 
1029-Danh muc Sach Giao Khoa khoi 6.pdf
1029-Danh muc Sach Giao Khoa khoi  6.pdf1029-Danh muc Sach Giao Khoa khoi  6.pdf
1029-Danh muc Sach Giao Khoa khoi 6.pdfQucHHunhnh
 
1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 -  Danh muc Sach Giao Khoa 10 . pdf1029 -  Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdfQucHHunhnh
 

Recently uploaded (20)

Spellings Wk 3 English CAPS CARES Please Practise
Spellings Wk 3 English CAPS CARES Please PractiseSpellings Wk 3 English CAPS CARES Please Practise
Spellings Wk 3 English CAPS CARES Please Practise
 
Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...
Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...
Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...
 
Vishram Singh - Textbook of Anatomy Upper Limb and Thorax.. Volume 1 (1).pdf
Vishram Singh - Textbook of Anatomy  Upper Limb and Thorax.. Volume 1 (1).pdfVishram Singh - Textbook of Anatomy  Upper Limb and Thorax.. Volume 1 (1).pdf
Vishram Singh - Textbook of Anatomy Upper Limb and Thorax.. Volume 1 (1).pdf
 
General Principles of Intellectual Property: Concepts of Intellectual Proper...
General Principles of Intellectual Property: Concepts of Intellectual  Proper...General Principles of Intellectual Property: Concepts of Intellectual  Proper...
General Principles of Intellectual Property: Concepts of Intellectual Proper...
 
Fostering Friendships - Enhancing Social Bonds in the Classroom
Fostering Friendships - Enhancing Social Bonds  in the ClassroomFostering Friendships - Enhancing Social Bonds  in the Classroom
Fostering Friendships - Enhancing Social Bonds in the Classroom
 
How to Create and Manage Wizard in Odoo 17
How to Create and Manage Wizard in Odoo 17How to Create and Manage Wizard in Odoo 17
How to Create and Manage Wizard in Odoo 17
 
How to Manage Global Discount in Odoo 17 POS
How to Manage Global Discount in Odoo 17 POSHow to Manage Global Discount in Odoo 17 POS
How to Manage Global Discount in Odoo 17 POS
 
2024-NATIONAL-LEARNING-CAMP-AND-OTHER.pptx
2024-NATIONAL-LEARNING-CAMP-AND-OTHER.pptx2024-NATIONAL-LEARNING-CAMP-AND-OTHER.pptx
2024-NATIONAL-LEARNING-CAMP-AND-OTHER.pptx
 
Food safety_Challenges food safety laboratories_.pdf
Food safety_Challenges food safety laboratories_.pdfFood safety_Challenges food safety laboratories_.pdf
Food safety_Challenges food safety laboratories_.pdf
 
Sociology 101 Demonstration of Learning Exhibit
Sociology 101 Demonstration of Learning ExhibitSociology 101 Demonstration of Learning Exhibit
Sociology 101 Demonstration of Learning Exhibit
 
Unit-IV; Professional Sales Representative (PSR).pptx
Unit-IV; Professional Sales Representative (PSR).pptxUnit-IV; Professional Sales Representative (PSR).pptx
Unit-IV; Professional Sales Representative (PSR).pptx
 
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdf
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdfUGC NET Paper 1 Mathematical Reasoning & Aptitude.pdf
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdf
 
Google Gemini An AI Revolution in Education.pptx
Google Gemini An AI Revolution in Education.pptxGoogle Gemini An AI Revolution in Education.pptx
Google Gemini An AI Revolution in Education.pptx
 
FSB Advising Checklist - Orientation 2024
FSB Advising Checklist - Orientation 2024FSB Advising Checklist - Orientation 2024
FSB Advising Checklist - Orientation 2024
 
Graduate Outcomes Presentation Slides - English
Graduate Outcomes Presentation Slides - EnglishGraduate Outcomes Presentation Slides - English
Graduate Outcomes Presentation Slides - English
 
Single or Multiple melodic lines structure
Single or Multiple melodic lines structureSingle or Multiple melodic lines structure
Single or Multiple melodic lines structure
 
Micro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdfMicro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdf
 
Unit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptxUnit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptx
 
1029-Danh muc Sach Giao Khoa khoi 6.pdf
1029-Danh muc Sach Giao Khoa khoi  6.pdf1029-Danh muc Sach Giao Khoa khoi  6.pdf
1029-Danh muc Sach Giao Khoa khoi 6.pdf
 
1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 -  Danh muc Sach Giao Khoa 10 . pdf1029 -  Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdf
 

Genetic predisposition to papillary thyroid cancer by Albert de la Chapelle, MD, PhD

  • 1. Genetic predisposition to papillary thyroid cancer Albert de la Chapelle The Ohio State University
  • 2. Fagin and Wells NEJM, 2016
  • 3. Heritability of selected cancers Thyroid 8.48 12.42 Testis 8.57 8.5 Multiple myeloma 4.29 5.62 Prostate 2.21 9.41 0.42 Colorectum 2.54 4.41 0.35 Breast 1.83 2.01 0.27 Lung 2.55 3.16 0.26 All cancers 2.15 3.53 Site Family risk ratio Utah1 Sweden2 Twin study3 (proportion of variance) 1. Goldgar et al. 1994 2. Dong and Hemminki 2001 3. Lichtenstein et al. 2000 Adapted from Risch 2001
  • 4. Odds ratio (OR) Odds ratio = likelihood of acquiring the phenotype (e.g. PTC) if marker present relative to when it is absent OR >1 is “predisposing” OR <1 is “protective” In the last few years the term odds ratio has begun to be called “effect size” OR and effect size are equivalent to “penetrance”
  • 5. Searching for predisposing genes • Loss of heterozygosity • Association studies • Next generation sequencing • Linkage analysis in families
  • 6. Linkage in PTC Literature • Between 1997 and 2006 at least 5 loci were proposed: 1p21, 2q21, 8p23, 14q32, 19p13 • Despite vigorous efforts no genes have been found • These data suggest genetic heterogeneity, multigenic and multifactorial inheritance, probably low penetrance.
  • 7. Main reason for failure of linkage analysis in PTC is Overdiagnosis (?) Unfortunately, the Next Generation Sequencing suffers from the same problem.
  • 8. • Definition of overdiagnosis “Diagnosis of those that would not, if left alone, result in symptoms or death” • “Overdiagnosis accounting for thyroid cancer in women South Korea 90% USA, Italy, France 70-80% Japan, Nordic countries, UK 50%” • “There is no evidence of new risk factors or increased exposure” NEJM 2016
  • 9. Ahn et al. NEJM, 2014
  • 10. M M M M M WT WT WT WT WT WT WT WTWT LOD score: 2.05
  • 11. M M M M M WT WT WT WT WT WT WT WTWT LOD score: 0.79
  • 12.
  • 13. Summary of candidate genes found by linkage OSU Chromosome Gene description No. families Ref 8q24 A lncRNA inside the TG gene 7 1 12q14 SRGAP1 4 2 4q32 An enhancer of unknown function 1 3 1. He et al. Cancer Res 2009 2. He et al. JCEM 2013 3. He et al. PLoS One 2013
  • 14. He et al. JCEM 2013 Whole genome linkage analysis of 38 PTC families
  • 15. Plot of the genome-wide linkage scan with posterior PPL from 38 families. He et al. JCEM 2013 (V. Vieland)
  • 16. SRGAP1, Slit-Robo Rho GTPase activating protein 1 gene • Located in 12q14; found by linkage • Different missense mutations segregate with PTC in 3 families • Missense mutations occur in sporadic cases and controls (OR 1.21, p=0.0008) • Missense variants impair the inactivation of CDC42, a key function • SRGAP1 is a candidate gene for PTC susceptibility and has low-medium penetrance
  • 17. A>C enhancer mutation in gene desert found by targeted deep sequencing He et al. PLoS One 2013
  • 18. Long-range enhancer mutation 4q32 A>C • Enhancer element is highly conserved • ChIP assay confirms enrichment of enhancer marks, e.g. H3K4me1 • Enhancer binds TFs POU2F and YY1 • Risk allele (C) greatly impairs TF binding • Enhancer RNA is greatly downregulated in thyroid tumors
  • 19. Enhancer A>C mutation in 4q32 is ultra rare • Found in 11 affected individuals of one large non-medullary thyroid carcinoma family • Not found in 38 other families • Not found in 2676 sporadic cases • Not found in 2470 controls • Target genes not yet found This suggests an ultra-rare, high- penetrance mutation
  • 20. Enhancer mutation in 4q32 Counseling • Initial pedigree had 11 affected individuals • Extensive counseling has resulted in much larger pedigree • Testing for mutation: positive 34/68 negative 34/68 • Sex ratio in mut. positive individuals: males n=17 females n=17
  • 21. Hypothesis Most of the heritability in PTC is due to (common?) low-penetrance genes The way of approaching these is….
  • 23. Genome-wide association studies, GWAS • Principle: search for marker that is more common in cases than in controls • Discovery test: type many (e.g. 1 million) SNPs in e.g. 1000 cases, 1000 controls • Validation test: type top SNPs (e.g. 50) in e.g. a further 2000 cases, 2000 controls • Replication test: type top SNPs (e.g. 5) in further cases and controls from different populations • Because of multiple testing, apply rigorous significance standards (e.g. p 10-8)
  • 24. GWAS-generated loci for PTC Summary, first two GWAS • 9q22 (OR 1.8) intergenic, apparently related to one or two lincRNA genes (data shown). FOXE1 nearby • 14q13 (OR 1.37) intergenic, risk allele affects thyroid specific lincRNA (data shown). NKX2-1 nearby • 2q35 (OR 1.34) in DIRC3 gene • 8p12 (OR 1.36) in first intron of neuroregulin (NRG1) gene. Risk allele lowers gene expression • 14q13 (OR 2.09) intergenic, close to but independent of first 14q13 locus
  • 25. Putative lincRNA transcripts in 9q22 PTCSC = papillary thyroid cancer susceptibility candidate unspliced transcript of PTCSC2 (>60 Kb) spans the genomic region containing SNP rs965513. rs965513 Shared haplotype rs1877431 rs10983700 rs1561960 rs7871887 rs1867277 FOXE1 PTCSC2- unspliced PTCSC2- spliced
  • 26. Three enhancers and 4 functional variants in a ~33 kb block in 9q22 He et al. PNAS 2015
  • 27. 89 kb 247 kb Two GWAS SNPs in Chromosome 14q13.3 PTCSC3 rs944289 MBIP rs116909374 SFTA3 NKX2-1 30 kb lincRNA (TCONS_00022711)
  • 29. 0.20.40.60.8 2^-(DeltaCt) Normal, NKX2.1 Vs rs944289 CC n=11 CT n=33 TT n=28 0.20.40.60.8 2^-(DeltaCt) Tumor, NKX2.1 Vs rs944289 CC n=11 CT n=31 TT n=29 rs944289[T] Adjacent unaffected Tumor CC n=11 CT n=31 TT n=29 CC n=11 CT n=31 TT n=29 2^-deltaCt 2^-deltaCt The risk allele [T] of the SNP increases the expression of NKX2-1 (TTF1) in thyroid tissue Kruskal test p-value =0.0899 Pairwise Wilcoxon test, TT vs CC, p value= 0.14 TT vs CT, p value= 0.046 Kruskal test p-value =0.0200 Pairwise Wilcoxon test, TT vs CC, p value= 0.074 TT vs CT, p value= 0.0074
  • 30. PTC: Examples of clinical association at the 14q13 locus Data from genotyping 1216 cases and 1416 controls • rs965513 associates with larger tumor size (p=0.025) and extrathyroidal expansion (OR=1.29, p=0.045) • Rs2439302 associates with lymph node metastasis (OR 1.24, p=0.016) and multifocality of the tumor (OR 1.24, p=0.012) Much more to come… Jendrzejewski et al. Thyroid 2016
  • 31. Predictive power of GWAS loci Towards the development of a risk panel • 5 loci described so far • ORs range from ~1.4 to ~2.1 • Are these ratios additive? 2 large cohorts of cases and controls genotyped for the 5 loci Ohio 747 cases 1047controls; Warsaw 1795 cases 2090 controls Additive risks sought Liyanarachchi et al. Thyroid 2013
  • 32. Cumulative odds ratios relative to number of risk alleles for 5 GWAS SNPs Liyanarachchi et al. Thyroid 2013
  • 33. Third GWAS deCODE + OSU Paper submitted, Gudmundsson et al. 2016 •Previous 5 loci confirmed •5 new loci detected •Involvement of coding genes observed
  • 34. Next generation sequencing (NGS) * Whole exome sequencing WES * Whole genome sequencing WGS • In principle predisposing genes can be found in individual patients by whole genome sequencing and perfect bioinformatics • In practice this does not work • Power of resolution can be improved by studying families searching for variants shared by affecteds • When families are reasonably large linkage can help focus search for relevant variants • Discrimination power can be enhanced by haplotyping • NB overdiagnosis of PTC
  • 35. WES of PTC • Our first NGS experiment • Study 7 PTC families with > 4 affected • Do WES on 2 affected/family • Present results: Positive finding in 2
  • 36. Whole exome sequencing in 7 PTC families * * * * * * * * * * * * * Whole Exome Sequencing * Genotyping used for Linkage Analysis ** * * * * * * * * * * * *
  • 37. Filtering principles and results Conditions and filtering No. of variants • Variants detected ~1 million/individual • Quality filtering ~200,000/individual • Elimination of common variants (>0.01) ~10,000/individual • Variant shared by the 2 affecteds ~2000/family • Not found in other than one family ~400/family • Deleterious by nature of variant & conservation ~100/family • Expressed in thyroid ~40/family Akagi, Symer et al.
  • 38. How to filter the remaining candidates (n=40) • Validate mutation by Sanger • Literature (cancer involvement?) • Databases (same mutation seen?) • Cosegregation in the family • Genotyping results from deCODE • Linkage (peak or valley) • Haplotype sharing • Population occurrence
  • 39. Segregation of SRRM2 c.1037 (S346F) variant in Family 7 Haplotype sharing Typing of PTC cases and controls: 7/1170 sporadic cases 0/1404 controls OR = 8.14; p-value = 0.049 0/138 familial cases
  • 40. Haplotype sharing: a good filter to eliminate candidate variants (Final 21 candidates from Family 7)
  • 41. Linkage analysis of Family 7 SRRM2 (chr 16)
  • 42. SRm300 aka SRRM2 Gene (Serine/arginine repetitive matrix protein 2) NM_016333: 9379 nt in 15 exons Ser346Phe S346F 1 human 339 KDKDKKEKSATRPSPSPERSSTGPEPPAPTPLLAERHGGSPQPLAT 383 mouse 241 KD--KKEKSAVRPSPSPERSSTGPELPAPTPLLVEQHVDSPRPLAA 285 chimpanzee 339 KDKDKKEKSATRPSPSPERSSTGPEPPAPTPLLAERHGGSPQPLAT 383 pig 339 KGKDKKEKSAVRSSPSPERSSTGPEPPAPTPLLAEQHGGSPQPLAT 383 dog 339 KDKE-KEKSGIRPSPSPERSSTGPEPPAPTPLLAEQHGGSPQPLAT 381 cat 263 KDKD-KEKSAIRPSPSPERSSAGPEPPAPTPLLAEQHGGSPQPLAT 307 cattle 338 KD--KKEKSAVRPSPSPERSNTGPEPPAPTLLLAEQHGGSPQPLAT 381 sperm whale 355 KDKDKKEKSAVQPSPSPERSSTGPELPAPTPLLAEQYGGSPQPLAT 400 2752 RSD-1 RSD-2 Protein: 2752 aa  300 kDa
  • 43. Heat map of 1642 alternative splicing events RNA-Seq data: alternatively spliced transcripts in the cases were differentially expressed when compared to controls PSI: the ratio of the “included” expression level vs. the sum of both spliced isoforms. Yellow: higher PSI. Blue: lower PSI.
  • 44. Main problems • Only coding DNA typed • Unexpectedly common mutation (>1%; >3% etc.) would be filtered out • Only mutations classified as “pathogenic” are considered
  • 45. 121781 $ $ $ 144961 150004 $ $ $ $ 128705 $ $ $ $ $ $ $ * ** $ $ $ * ** 3 6 $ $ $ 89281 75700 69238 20778 * PTC Melanoma ** PTC & melanoma Goiter or nodules Other benign thyroid disease KEY Spherocytosis $, Whole genome sequence Other malignancy $ $ $ $$ $ $ $ $ $ Whole genome sequencing performed in 8 families
  • 47. Whole genome sequencing in PTC families Summary of results in 8 families • Filtering excluded everything except coding variants of genes expressed in thyroid tissue and with predicted pathogenicity • The median number of remaining candidate genes per families was 27 (range 14-83) • Efforts to identify the correct gene(s) are underway
  • 48. So What? Consequences of gene discoveries • Improved molecular insight; pathways? Yes but slow • Diagnosis? Yes but mainly in families • Clinical stratification? Promising but so far modest impact

Editor's Notes

  1. Now to our story. Our study was designed based on the availability of PTC affected families.