1. EET310 – Programmable Controllers and Robotics
Unit 3
By: Brett Bloomberg
Instructor:
William Routt
Online EET Department
ECPI University
Date: 10/11/2016
ECPI’s Honor Pledge: I pledge to support the Honor System of ECPI. I will refrain from any form of
academic dishonesty or deception, such as cheating or plagiarism. I am aware that as a member of
the academic community it is my responsibility to turn in all suspected violators of the honor code. I
understand that any failure on my part to support the Honor System will be turned over to a Judicial
Review Board for determination. I will report to a Judicial Review Board hearing if summoned.
Brett Bloomberg
2. Objective:
Thislab helpedusreinforce the more advance applicationsthatPLC’scan offer.We learnedhow to
program a cross walkona busystreet,aswell asfill abig tankand emptyit.These topicsandproblems
that we solvedusingPLC’sallowustobecome betterautomationengineers,andbetterproblemsolvers.
Thislab tookour educationandtestedourmental abilitytofigure outhow tohandle certaintasksand
make themautomated.
Lab 7-11
Thislab asksus to implementthe fluidpumpingprocessPLCprogramshown.The program asksus to
make the program complete the followingtasks.
Whenthe start buttonis pushed,the pumpstarts.The buttoncan thenbe released,andthe pump
continues.
Whenthe stop buttonispushedthe pumpstops
Before startingPS1must be closed
PS2 and PS3 mustbe closed5 secondsafterthe pump starts.IF eitherps2or ps1 opensthe pumpwill
shutoff and will notbe able to start againfor another14s.
The inputsare as follows
StopI:1/0
Start I:1/1
PS1 I:1/2
PS2 I:1/3
M O:2/0
Tof T4:5
Ton T4:6
As we can see fromthe picture belowthatthe program isprettysimple.Whenthe startbuttonis
pushedthe pumpwill latchon.Thisonlyworksif PS1 isclosed.The pumpwill pumpfor5 secondsonce
the pumpis overthe pumptime kicksinand takes14 secondsbefore itcan be run again.
3. Conclusion:
Thisprogram isn’ttoobad. It’sa simple pumpstationprogramthatallowscertainsensorstobe made
and certainsafetyfeatureslike the pumpnotturningbackon for14 secondsonce it’sbeenturnedon.
Thisladderlogichelpedusstartusing timerswithbothondelayandoff delay.
4. Lab 7-13
Thislab asksus to implementthe bearinglubricationPLCprogramshowninthisapplicationwe are
askedto.
To start the machine the operatorturns SW On
Before the motorshaftstarts to turn,the bearingsare suppliedwithoil bythe pumpfor10s.
Whenthe operatorturns SW “OFF” to stopthe machine,the oil pumpcontinuestosupplyoil for15s.
A retentive timeris usedtotrack the total runningtime of the pump.Whenthe total runningtime is3 H
the motor isshut downanda pilotlightisturned“on”to indicate thatthe filterandoil needtobe
changed.
A resetbuttonisprovidedtoresetthe processafterthe filterandoil have beenchanged.
Input/outputs.
SwitchI:1/0
ResetI:1/1
PumpO:2/0
Motor O:2/1
Pl O:2/2
Ton T4:0
Tof T4:1
RTO T4:2
5.
6. The picture above iswhenthe pilotlightcomesonthat indicatesit’stime toreplace the oil filterinthe
system. A retentive timerisusedtotrack the total runningtime of the pump.Thiswill helpkeeptrack
of time evenwhenthe powergoesout. Whenthe timerreachesthree hoursthe lightwill turnonto
indicate thatthe filterneedstobe changed.The machine will continue topumpevenwhenthe user
stopsit for15 secondsafter. There isa resetbuttonto resetthe counterwhenthe filterhasbeen
changed.
7. Lab 7-37
Thislab asksuse to implementatrafficflow ona one way streetisto be controlledbymeansof a
pedestrianpushbuttonsothatthe greentrafficlightanddon’twalkindicatorsare to be normallyonat
all timeswhenthe pedestrianpushbuttonisnotactuated.Whenthe pedestrianpushbuttonisactuated,
the timingisstartedand controlsthe outputas follows.
The greentrafficlightimmediatelyswitches“off”andthe ambertrafficlightswitchesontobeginthe
stopthe trafficflow.The outputsremaininthe startfor 5 seconds.
The amber trafficlightswitchesoff andthe redtrafficlightswitchesonthe outputsremaininthisstate
for 5 seconds,toensure that traffichasstoppedbefore pedestriansbegintocross.
The walkpedestrianslightswitchesonandthe redtrafficlightremainson.The outputsremaininthis
state for 15 seconds.Allowingpedestrianssafe passage acrossthe street.
The walkpedestrianslightswitchesoff andthe redtrafficlightremainson. The outputsremaininthis
state for 5 secondstomake sure that pedestriansare notstill crossingthe streetwhenthe trafficlight
changesfromred to green.
The greentrafficlightswitchesonandthe red trafficlightswitchesoff.The outputsremain inthisstate
for at least30 secondstoensure a minimumamountof automotivetrafficflow timeevenif the walk
pushbuttonispressedtostartthe cycle again.
The inputsand outputs
WalkpushbuttonI:1/0
RedlightO:2/0
AmberlightO:2/1
GreenlightO:2/2
PedestrianwalkO:2/3
Internal B3:1/0
Internal B3:1/1
Ton T4:1
Ton T4:2
Ton T4:3
Ton T4:4
Ton T4:5
8.
9. Thiswas one of the harderlabsthat I have workedonin thiscourse so far.I may have overthinkit.Tobe
more complex thanitwas I learnedfromthislabthatit isdifficulttostarta timerfroma timer.Inmost
of the timershere Iwas unable tostart the timerfroman existingtimer. WhichiswhyI insertedrung
10. Keepingthe greenlightonwhile nothingwasgoingonSeemedharderthanitshouldhave been.I
knowI couldhave gone aboutit anotherwaythat was a smallercode,butI wasstill able togetit
completed.Iamsure I have some redundancywithinmycode thatdoesn’tneedtobe there.Reallythe
onlyhard part aboutthiswas keepingthe greenlightgoingornotgoingwhile itturnedcolorsafterthat
it wasprettystraightforward.
Lab 8-13
Thislab asksus to implementthe automaticstackingprocessshow.InthisprocessconveyorM1is used
to stack metal platesontoconveyorM2. The photoelectricsensorprovidesaninputpulse tothe PLC
countereach time a metal plate dropsfromconveyorM1 to M2. When15 plateshave beenstacked,
conveyorM2 isactivatedfor5 secondsbythe PLC timer.The operationcanbe summarizedby.
Whenthe start buttonis pressed,conveyorM1 beginsrunning.
After15 plateshave beenstacked,conveyorM1 stops and conveyorM2 beginsrunning.
AfterconveyorM2 has beenoperatedfor5 seconds,itstopsand the sequence isrepeated
automatically.
The done bit of the timerresetsthe timerandcounterand providesamomentarypulse toautomatically
restartconveyorM1.
Use the inputsoutputs.
StopPB I:1/0
Start I:1/1
ConveyorM1 O:2/0
ConveyorM2 O:2/2
Ton T4:1
Ctu C5:1
10. Thislab isprettyeasy.We want to make sure that WhenM1 is runningM2 isnot running. Andthatthe
photosensoriscountingto 15. Once the count isat 15 M2 starts andit starts a timerthat runsfor 5
seconds.Once thishappensthe timerresetsthe counterwhichalsothenresetsthe timer.
11. Thislab wasprettystraightforwardin termsof countingand timing.Iwill saythatthe metal fallingonto
conveyortwoseemslike itwill causesmajorerrors.We are leavingthe metal tofall onitsownwithno
wayof guidance whichmayor may nottrip the photosensor.Whichcouldcause the counterto not
count properlybyaddinganotherheightsensorthe conveyortwowe couldeliminatethe counterror
12. witha redundancycheckerof height,butwiththiswe are alsoleavingalotup to fate in termsof the
systemrunningproperly?
Lab 8-28
Thislab asksus to documenta PLC programthat will implementthe box stackingprocess.This
applicationrequiresthe control of aconveyorbeltthatfeedsamechanical stacker.The stackercan stack
variousnumbersof cartonsof ceilingtile ontoeachpalletdependingonthe palletsize andthe preset
value of the counter.Whenthe reuirednumberof cartonshas beenstacked,the conveyorisstopped
until the loadedpalletisremovedandanemptypalletisplacedontothe loadingarea.A photoelectric
sensorwill be usedtoprovide countpulsestothe counteraftereachcarton passesby.In additiontoa
conveyormotorstart/stopstation,aremote resetswitchisprovidedtoallow the operatortoresetthe
systemfromthe forkliftafteranemptypalletisplacedontothe loadingarea.The operationof this
systemcan be describedasfollows.
Pressingthe startbuttonstarts the conveyor.
As eachbox passesthe photoelectricsensor,acountis registers.
Whenthe presetvalue isreached(20) the conveyorturnsoff.
The forkliftoperatorremovesthe loadpallet.
Afterthe emptypalletisinposition,the forkliftoperatoractivatesthe remoteresetswitchwhichthen
starts the whole cycle overagain.
ConveyorstartbuttonI:1/0
StopbuttonI:1/1
SensorI:1/3
ResetswitchI:1/6
Motor O:2/0
CounterC5:1
The ladderlogicisas follows.
13. I may nothave put enoughthoughtintothislabas I shouldhave.Imay have simplifiedittoomuchto
not be exactlywhatiscalledfor.The motor can be resetby the operator,or itcan be stoppedbythe
counter.It seemsprettystraightforwardonhow the ladderlogicissupposedtowork.
14. Lab 8-36
Usingthe batch simulatorscreen,writeaprogramthat will implementthe followingtankfillingand
mixingsequence.
I wasn’tsure what thiswasaskingfor.I justdid the programlike normal andran the inputsandoutputs.
The program asks.
The start buttonispressedtostart inputpumpp1.
After100 gallonsone flowmeterpulsepergalloninputpumpp1stopsautomaticallyandthe mixer
motor starts.
The mixermotoris automaticallystoppedafter30seconds,andthe inputpumpP1 isstarted.
Afteran additional 60gallonsare pumpedintothe tank,the inputpumpstopsand the mixermotor
starts.
The mixermotoris operatedfor20 secondsandstops.
The discharge pumpP3 motor isstartedautomaticallyandrunsuntil the low level sensorisactuated.
The processstops.
The inputs/outputs.
Start I:1/0
StopI:1/1
FlowI:1/5
Low level I:1/3
15. Mix motorO:2/0
P1 O:2/1
P3 O:2/3
Internal relayB3:0/0
CTU c5:1
Ctu C5:2
RTO T4:1
RTO T4:2
Thiswas an interestinglabtocreate and tooksome thoughtand efforttofullyunderstandandmake it
somewhatsimplistic.Ididnotuse the internal relayIdidn’tsee the needforit.Imay have beenable to
use it,but I couldn’tfindaneedto use it.The start buttonwas easyenoughlockinthe pump flowing
and have the first100 gallonsopenupthe pumponce it wasdone.The countersand flow IthoughtI did
verywell.Itmaynot be perfect,butI thinkitfitsfor thisapplication.The flow needstostartbypumping
100 gallonsintothe tank,once that happensitturnson the mixermotorandwe turns off after30
seconds.Afterthe 30 secondsthe pumpstarts back up andit countsfor 60 gallons.Afterthatonce the
pumpis full itwill starttopump until the low levelpumpismade.
16. Conclusion:
I may nothave usedto correct simulatorswiththese labs,sinceIwasn’treallysure how touse them and
if I was usingthemcorrectly.Ijuststuck withthe inputsandoutputsthat wayI knew exactlywhatwas
goingon.These labswere challenginganda lotof funtoo.I feel Imay nothave understoodthe traffic
labas well asIshouldhave I had a problemwiththatone.Itwas hard keepingthe lightgreenanddoing
everythingthatwasneededwhileitwasoff,butturningthe lightbackon againwas the challenge.I
enjoyedthese labsotherthanthatand was able toreallygaina good graspon the advancedtopicsthat
PLC’soffer.Ibelieve Iamstartingto reallybreakdowneachsectionof the ladderlogic.
References:
Petruzella,F.(2011) LogixproPLC labmamual foruse withprogrammable logiccontrollers( fourthed).
NewYork,NY: McGraw-Hill
Petruzella,F.D.(2011). LogixPro PLClab manualforusewith programmablelogiccontrollers. NewYork,
NY: McGraw-Hill.
LogixPro(VersionTLP) [Computersoftware].(n.d.).