Avacta Life Sciences Affimers Presentation Global Protein Engineering Summit (PEGS)

Biological Recognition:
Beyond the Antibody
Paul Ko Ferrigno
Chief Scientific Officer
This talk
• Antibodies and the need for new scaffolds
• Historical perspective- scaffolds
• Next generation scaffolds- design considerations
• Affimer performance
Biological Recognition- Antibodies
Antibodies
• Are fantastic
diagnostic tools
• Are pretty good
reagents for research
• Can be made to be
good drugs
Why?
• Optimisation
• Large binding surface
area
• Constant region allows
generic protocols
But antibodies…
• Can suffer from cross-reactivity
• Can be difficult to express
• Can be difficult to engineer
• Can be difficult to use
• Generating a functional binder for each
element of proteome is a huge challenge
What we need to do- Human Protein Atlas
Berglund et al (2008) Proteomics 2008, 8, 2832–2839
Validation
score
Validation
category
Criteria Number of
antibodies
Fraction
%
1. High Supportive Two independent antibodies with similar staining pattern
consistent with experimental and/or bioinformatics data
687 7
2. Medium Supportive Staining pattern consistent with experimental and/or
bioinformatics data
1414 15
3. Low Uncertain Staining pattern partly consistent with experimental
and/or bioinformatics data
1853 20
4. Very low Uncertain No literature or bioinformatics data available 861 9
5. Failed Failed Staining pattern not consistent with experimental and/or
bioinformatics data
4543 49
Where we are- Catalogue reagents and HPA
TABLE II Validation of 9358 internally generated antibodies
Berglund et al (2008) A Genecentric Human Protein Atlas for Expression Profiles Based on Antibodies.
Molecular & Cellular Proteomics, 7, 2019-2027.
5436 external antibodies from 51 different antibody providers were obtained and subsequently validated. Of these, 1410 monoclo
nal antibodies and 1316 polyclonal antibodies were approved by a standardized validation using Western blotting and IHC on tissue
microarrays as described above. The success rates (…) showed (…) an average success rate of 49%.
If half of all research antibodies tested fail…
Research: huge amount of
time wasted in finding the
right reagent
Proteomics: limited
coverage, limited
understanding
Pharma: new target, but no
tools= no assays = no drugs
First Gen Scaffolds
Binz, Amstutz & Plückthun, Nature Biotech 23, 1257 - 1268 (2005)
Why do we need more scaffolds?
• Early scaffolds started as academic research projects
• Later ‘fit for purposes’ scaffolds may rely on
untested assumptions
• Purpose may dictate scaffold choice-but what
happens if the experimental paradigm changes?
• Multiplexing represents unique challenges, but is
needed for personalised medicine/CDx
Next Gen Scaffolds
A successful non-Ab scaffold protein should be:
(1) of known structure: informed choice of the site for peptide insertion or
replacement
(2) stable: to constrain the folding of a broad range of peptides
(3) flexible: folding not affected by peptide inserts
(4) biologically neutral: lacking interactions with irrelevant proteins
(5) well-expressed in prokaryotic and eukaryotic environments, data obtained in one
system informs experiments performed in the other
Woodman et al, J Mol Biol, 2005
Woodman et al, J Mol Biol, 2005
Affimers start from a robust, neutral and versatile scaffold
Small- 98 aa
Lysosomal resident
Protease inhibitor
No cys
Well understood interaction
surfaces: very similar to Ab
Capable of 1 fM KD
Affimers are robust to extremes of pH
wavelength (nm)
Peptide presentation and protein yields
100
50
0
200
SQM SQT
Affimers: non-antibody binding proteins derived from Stefin A
Multiple libraries
CIS display: 10
12
Phage display: 10
10
Y2H: >10
8
Microarray: >10
4
Speed of Screening
ka (1/Ms) kd (1/s) Rmax (RU) RI (RU) Conc of analyte KA (1/M) KD (M) Req (RU) kobs (1/s) Chi2
6.76e3 2.15e-5 44.1 -1.28 1000n 3.15e8 3.18e-9 44 6.78e-3 0.0331
0
0.5
1
1.5
2
2.5
2.50 1.25 0.63 0.31 0.16 0.08 0.04 0
AbsorbanceOD480nm
Coat Concentration (µg/mL)
Direct ELISA of Ψ F6 against Human Recombinant
Procalcitonin
No Ψ Ψ F6
Binders generated in 7 weeks.
LOD ~ 0.16 μg PCL /mL in a non-signal amplified direct ELISA.
Biacore trace
Kd= 3 nM
Baseline ELISA- No signal amplification
1:1:1 binding between Target, Affimer and Secondary
0
0.2
0.4
0.6
0.8
1
1.2
1.4
1.6
1.8
0 0.2 0.4 0.6 0.8 1 1.2 1.4
AbsorbanceOD450nm
Target Coating Concentration (μg/mL)
Direct ELISA against TargetX with ΨE3
Gal7 ΨE3 Secondary Control
0
0.1
0.2
0.3
0.4
0.5
0.6
0.7
0 0.2 0.4 0.6 0.8 1 1.2 1.4
AbsorbanceOD450nm
Target Coating Concentration (μg/mL)
Direct ELISA against IL-2 with 2 Ψ's
IL-2 ΨA3 IL-2 ΨF3 Secondary Control
0
0.2
0.4
0.6
0.8
1
1.2
1.4
1.6
1.8
2
0 0.2 0.4 0.6 0.8 1 1.2 1.4
AbsorbanceOD450nm
Target Coating Concentration (μg/mL)
Direct ELISA against IL-6 with ΨA7
IL-6 ΨA7 Secondary Control
X
-0.5
0
0.5
1
1.5
2
2.5
3
0 0.2 0.4 0.6 0.8 1 1.2 1.4
Absorbance(450-620nm)
Antibody coat concentration (μg/mL)
Anti-rabbit IgG Affimer D1 is highly specific
rIgG
mIgG1
mIgG2a
mIgG2b
mIgG3
rat IgG
donkey IgG
sheep IgG
chicken IgG
goat IgG
mouse IgM
canine IgG
Western Blotting
Anti-SAA
Clone E12 Lysate
Lanes 1, 4 & 7 – Life Tech SeeBlue Plus 2 Marker,
5μl
Lanes 2, 5 & 8 – HeLa RIPA lysate, 10 μg, reduced
Lanes 3, 6 & 9 – Recombinant SAA, 0.1 μg,
reduced
Binder
Lanes 1, 2 & 3 – Anti-SAA Ψ, 0.5 μg/ml
Lanes 4, 5 & 6 – Anti-SAA Ψ, 5 μg/ml
Lanes 7, 8 & 9 – No binder
Detection
All Lanes – ab1187 anti-6xHis Rabbit Polyclonal,
HRP conjugated, 1/5000
Affimers to Small Molecules
0
0.2
0.4
0.6
0.8
1
1.2
1 2 3 4 5 6 7 8
AbsorbanceOD480nm
Clone ID
Phage ELISA of candidate Posaconazole binders from a screen
Posaconazole+Linker
Posaconazole+Linker & Free
Posaconazole
Posaconazole+Linker & Free
Voriconazole
No Coat Control
Posaconazole
Voriconazole
Isoform Specificity and Intracellular Use
inactive active
p85 regulates p110 lipid kinase activity via its SH2 domain.
In the presence of a p85 SH2 binding protein the inhibition is
released, activating p110
Active p110 inhibits phosphorylation of Akt
Isoform Specificity and Intracellular Use
Binders were generated to the SH2 domains of PI3K subunits.
PI3K p85A N-term
PI3K p85B N-term
PI3K p55G N-term
consensus
PI3K p85A N-term
PI3K p85B N-term
PI3K p55G N-term
consensus
0
0.2
0.4
0.6
0.8
1
1.2
1.4
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24
AbsorbanceOD450nm
Clone ID
p85A C p85A N p85B C p85B N p55G C p55G N control
Phage ELISA results of a screen against the PI3K P85A N-terminal SH2 domain
Isoform Specificity and Intracellular Use
Candidate Affimers were expressed in 3T3 cells and shown to increase pAKT.
Inhibition does not correlate with expression level ie some Affimers
are more potent
Affimer Arrays for Protein Detection
25,000 features
LLOD currently
pg/mL in human
serum
Signatures of Drug Action
- DMSO 0.5 1 2 4 hours Staurosporine
Up-regulated Down-regulated
Panel A: Cells treated with staurosporine undergo apoptosis.
A
B
Panel C: highlights of some of the 336 other Affimers also gave
altered signals- some proteins decreasing (probably representin
g proteins cleaved in apoptosis) while others are increasing (po
ssibly reflecting the detection of cleaved products)
Panel B: At 4 hours, after treatment with drug or carrier (DMSO)
cells were lysed and proteins fluorescently labelled with Cy3 or C
y5. 17k Arrays were challenged with a mixture of these labelled l
ysates. Affimers binding proteins such as BAD, known to be incre
ased in apoptosis, showed increased signals from cells treated wi
th staurosporine. Affimers recognising proteins cleaved in apopt
osis, such as CDK2, showed decreased signals. Affimers binding B
CL6, a protein whose levels have not been investigated in apopto
sis, suggest this protein is down-regulated.
Sumoylation
Yeast-SUMO-_smt3_ MSESPSANISDADKSAITPTTGDTSQQDVKPSTEHINLKVVGQDNNEVFFKIKKTTEFSK
Human-SUMO1 --------MSDQEAKPSTEDLGD------KKEGEYIKLKVIGQDSSEIHFKVKMTTHLKK
Human-SUMO2 --------MADEKPKEGVKTENN----------DHINLKVAGQDGSVVQFKIKRHTPLSK
::* . . . .: ::*:*** ***.. : **:* * :.*
Yeast-SUMO-_smt3_ LMKIYCARQGKSMNSLRFLVDGERIRPDQTPAELDMEDGDQIEAVLEQLGGCTHLCL
Human-SUMO1 LKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV--
Human-SUMO2 LMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY----
* : ** *** .*..:** .:*: * .** :* **: * *:. :* **
Yeast SUMO binders and Species Specificity
ITC: Ψ-Clone 10
Ψ-Clone 10
Ψ-Clone 15
Ψ-Clone 19
Ψ-Clone 22
YeastSUMO
HumanSUMO1
HumanSUMO2
Ψ-Clone10
Ψ-Clone15
Ψ-Clone19
Ψ-Clone22
control
Yeast SUMO
Human SUMO1
Human SUMO2
AbsorbanceOD480nm
0
0.5
1.0
1.5
Binders were generated that were specific to yeast SUMO. Data shown are direct ELISA and
western blot results for 4 candidates against yeast SUMO and human SUMO 1 & 2. ITC for
one candidate shows a Kd of ~30 nM.
Summary
• Affimers are small, robust and versatile proteins
• The scaffold has been engineered to lack partners in
human systems
• Very large libraries can be quickly screened against
a broad range of targets
• The resulting binders are high affinity and
exquisitely specific
Acknowledgments
Screening/Validation
Christina Räuber
Laura Dicker
Davinia Fernandez
Rob Ford
Lindsay McMorran
Protein Expression
Paul Shadbolt
Emma Branson
Amanda Evans
Katarzyna Gorczak
Tony Kwok
Ruth Lunn
Graham Spence
Affimer Arrays
Kit-Yee Tan
Vincent Puard
University of Leeds
Mike McPherson
Darren Tomlinson
Christian Tiede
Anna Tang
Presentation by Paul Ko Ferringo
Head of R&D: Matt Johnson
For more info visit Avacta Life Sciences or contact chris.miller@avacta.com
1 von 27

Recomendados

Autophagy Research Focus by Proteintech von
Autophagy Research Focus by ProteintechAutophagy Research Focus by Proteintech
Autophagy Research Focus by ProteintechProteintech Group
12.5K views9 Folien
How to Optimize Your Immunofluorescence Staining von
How to Optimize Your Immunofluorescence StainingHow to Optimize Your Immunofluorescence Staining
How to Optimize Your Immunofluorescence StainingProteintech Group
23.5K views16 Folien
Combined thesis 1 von
Combined thesis 1Combined thesis 1
Combined thesis 1deepthesis
1.6K views97 Folien
Breaking the Status Quo: Using Mass Spectrometry to detect Host Cell Proteins von
Breaking the Status Quo: Using Mass Spectrometry to detect Host Cell ProteinsBreaking the Status Quo: Using Mass Spectrometry to detect Host Cell Proteins
Breaking the Status Quo: Using Mass Spectrometry to detect Host Cell ProteinsMerck Life Sciences
143 views31 Folien
ADCC Reporter Bioassay (AACR 2013) von
ADCC Reporter Bioassay (AACR 2013)ADCC Reporter Bioassay (AACR 2013)
ADCC Reporter Bioassay (AACR 2013)Neal Cosby
1.9K views1 Folie
ADCC Reporter Bioassay - V and F Variants: Novel, Bioluminescent Cell-Based A... von
ADCC Reporter Bioassay - V and F Variants: Novel, Bioluminescent Cell-Based A...ADCC Reporter Bioassay - V and F Variants: Novel, Bioluminescent Cell-Based A...
ADCC Reporter Bioassay - V and F Variants: Novel, Bioluminescent Cell-Based A...Neal Cosby
4.4K views53 Folien

Más contenido relacionado

Was ist angesagt?

SWON Alliance Cross Council AMR Collaborative von
SWON Alliance Cross Council AMR CollaborativeSWON Alliance Cross Council AMR Collaborative
SWON Alliance Cross Council AMR Collaborativewarwick_amr
513 views12 Folien
Setting up for successful lot release testing by Edmund Ang von
Setting up for successful lot release testing by Edmund AngSetting up for successful lot release testing by Edmund Ang
Setting up for successful lot release testing by Edmund AngMilliporeSigma
216 views37 Folien
Antibody Based Techniques Masterclass by Proteintech von
Antibody Based Techniques Masterclass by ProteintechAntibody Based Techniques Masterclass by Proteintech
Antibody Based Techniques Masterclass by ProteintechProteintech Group
191 views64 Folien
Immunohistochemistry von
ImmunohistochemistryImmunohistochemistry
ImmunohistochemistryShankar Bastakoti
3.2K views43 Folien
Structure-guided Design in the Discovery of Antimicrobials von
Structure-guided Design in the Discovery of AntimicrobialsStructure-guided Design in the Discovery of Antimicrobials
Structure-guided Design in the Discovery of Antimicrobialswarwick_amr
573 views44 Folien
LakePharma General Technical Overview von
LakePharma General Technical OverviewLakePharma General Technical Overview
LakePharma General Technical OverviewJin Di, Ph.D.
332 views19 Folien

Was ist angesagt?(20)

SWON Alliance Cross Council AMR Collaborative von warwick_amr
SWON Alliance Cross Council AMR CollaborativeSWON Alliance Cross Council AMR Collaborative
SWON Alliance Cross Council AMR Collaborative
warwick_amr513 views
Setting up for successful lot release testing by Edmund Ang von MilliporeSigma
Setting up for successful lot release testing by Edmund AngSetting up for successful lot release testing by Edmund Ang
Setting up for successful lot release testing by Edmund Ang
MilliporeSigma216 views
Antibody Based Techniques Masterclass by Proteintech von Proteintech Group
Antibody Based Techniques Masterclass by ProteintechAntibody Based Techniques Masterclass by Proteintech
Antibody Based Techniques Masterclass by Proteintech
Proteintech Group191 views
Structure-guided Design in the Discovery of Antimicrobials von warwick_amr
Structure-guided Design in the Discovery of AntimicrobialsStructure-guided Design in the Discovery of Antimicrobials
Structure-guided Design in the Discovery of Antimicrobials
warwick_amr573 views
LakePharma General Technical Overview von Jin Di, Ph.D.
LakePharma General Technical OverviewLakePharma General Technical Overview
LakePharma General Technical Overview
Jin Di, Ph.D.332 views
Cardiovascular Research Focus by Proteintech von Proteintech Group
Cardiovascular Research Focus by ProteintechCardiovascular Research Focus by Proteintech
Cardiovascular Research Focus by Proteintech
Proteintech Group12.6K views
Multi-domain Challenges of Fc Fusion Proteins and Bispecific Antibodies von Jin Di, Ph.D.
Multi-domain Challenges of Fc Fusion Proteins and Bispecific AntibodiesMulti-domain Challenges of Fc Fusion Proteins and Bispecific Antibodies
Multi-domain Challenges of Fc Fusion Proteins and Bispecific Antibodies
Jin Di, Ph.D.1.3K views
Western Blotting - Technical Tips and Troubleshooting von Proteintech Group
Western Blotting - Technical Tips and Troubleshooting Western Blotting - Technical Tips and Troubleshooting
Western Blotting - Technical Tips and Troubleshooting
Proteintech Group30.4K views
Chemical Evolution of B Lactams to Keep Pace with Bacterial Resistance von warwick_amr
Chemical Evolution of B Lactams to Keep Pace with Bacterial ResistanceChemical Evolution of B Lactams to Keep Pace with Bacterial Resistance
Chemical Evolution of B Lactams to Keep Pace with Bacterial Resistance
warwick_amr983 views
How To Optimize Your Immunohistochemistry Experiment von Proteintech Group
How To Optimize Your Immunohistochemistry ExperimentHow To Optimize Your Immunohistochemistry Experiment
How To Optimize Your Immunohistochemistry Experiment
Proteintech Group33.5K views
Alkemists - Analytical Services Triad von AlkemistsLabs
Alkemists - Analytical Services TriadAlkemists - Analytical Services Triad
Alkemists - Analytical Services Triad
AlkemistsLabs374 views
Western Blotting(Mohan Prakash) von mp535
Western Blotting(Mohan Prakash)Western Blotting(Mohan Prakash)
Western Blotting(Mohan Prakash)
mp5351.3K views
Western blotting test von rajexh777
Western blotting testWestern blotting test
Western blotting test
rajexh77718.2K views

Similar a Avacta Life Sciences Affimers Presentation Global Protein Engineering Summit (PEGS)

Using Computational Toxicology to Enable Risk-Based Chemical Safety Decision ... von
Using Computational Toxicology to Enable Risk-Based Chemical Safety Decision ...Using Computational Toxicology to Enable Risk-Based Chemical Safety Decision ...
Using Computational Toxicology to Enable Risk-Based Chemical Safety Decision ...U.S. EPA Office of Research and Development
831 views35 Folien
MDC Connects: Cell-based screening: Old dogs with new tricks von
MDC Connects: Cell-based screening: Old dogs with new tricksMDC Connects: Cell-based screening: Old dogs with new tricks
MDC Connects: Cell-based screening: Old dogs with new tricksMedicines Discovery Catapult
782 views19 Folien
Cupid Peptides presentation wjr von
Cupid Peptides presentation wjrCupid Peptides presentation wjr
Cupid Peptides presentation wjrCupid Peptides
107 views30 Folien
SARomics Biostructures' Company and Services Presentation von
SARomics Biostructures' Company and Services PresentationSARomics Biostructures' Company and Services Presentation
SARomics Biostructures' Company and Services PresentationSalam Al-Karadaghi
238 views43 Folien
Bioinformatic data analysis – comparison from three human studies using diffe... von
Bioinformatic data analysis – comparison from three human studies using diffe...Bioinformatic data analysis – comparison from three human studies using diffe...
Bioinformatic data analysis – comparison from three human studies using diffe...Agnieszka Caruso
873 views34 Folien
Osp2 brennan SGC von
Osp2 brennan SGCOsp2 brennan SGC
Osp2 brennan SGCAlina Grenier-Arellano
303 views22 Folien

Similar a Avacta Life Sciences Affimers Presentation Global Protein Engineering Summit (PEGS)(20)

Cupid Peptides presentation wjr von Cupid Peptides
Cupid Peptides presentation wjrCupid Peptides presentation wjr
Cupid Peptides presentation wjr
Cupid Peptides107 views
SARomics Biostructures' Company and Services Presentation von Salam Al-Karadaghi
SARomics Biostructures' Company and Services PresentationSARomics Biostructures' Company and Services Presentation
SARomics Biostructures' Company and Services Presentation
Salam Al-Karadaghi238 views
Bioinformatic data analysis – comparison from three human studies using diffe... von Agnieszka Caruso
Bioinformatic data analysis – comparison from three human studies using diffe...Bioinformatic data analysis – comparison from three human studies using diffe...
Bioinformatic data analysis – comparison from three human studies using diffe...
Agnieszka Caruso873 views
Eradicating diseases (genome) von Utkarsh Verma
Eradicating diseases (genome)Eradicating diseases (genome)
Eradicating diseases (genome)
Utkarsh Verma926 views
Spring Research Paper FINAL von Hameeda Naimi
Spring Research Paper FINALSpring Research Paper FINAL
Spring Research Paper FINAL
Hameeda Naimi111 views
Protein-protein interaction von sigma-tau
Protein-protein interactionProtein-protein interaction
Protein-protein interaction
sigma-tau2.7K views
Recombinant protein expression and purification Lecture von test
Recombinant protein expression and purification LectureRecombinant protein expression and purification Lecture
Recombinant protein expression and purification Lecture
test31.2K views
Target Validation / Biochemical and Cellular Assay Development von OSUCCC - James
Target Validation / Biochemical and Cellular Assay Development Target Validation / Biochemical and Cellular Assay Development
Target Validation / Biochemical and Cellular Assay Development
OSUCCC - James3.6K views
Hepatitis C von mafsana
Hepatitis CHepatitis C
Hepatitis C
mafsana466 views
Explaining Biocide Tolerance of Gram Negative Bacteria von Kate Barlow
Explaining Biocide Tolerance of Gram Negative Bacteria Explaining Biocide Tolerance of Gram Negative Bacteria
Explaining Biocide Tolerance of Gram Negative Bacteria
Kate Barlow109 views
132 gene expression in atherosclerotic plaques von SHAPE Society
132 gene expression in atherosclerotic plaques132 gene expression in atherosclerotic plaques
132 gene expression in atherosclerotic plaques
SHAPE Society284 views
Long Acting Injectables - A New Dimension for Proteins and Peptides von Merck Life Sciences
Long Acting Injectables - A New Dimension for Proteins and PeptidesLong Acting Injectables - A New Dimension for Proteins and Peptides
Long Acting Injectables - A New Dimension for Proteins and Peptides

Último

domestic waste_100013.pptx von
domestic waste_100013.pptxdomestic waste_100013.pptx
domestic waste_100013.pptxpadmasriv25
10 views17 Folien
RemeOs science and clinical evidence von
RemeOs science and clinical evidenceRemeOs science and clinical evidence
RemeOs science and clinical evidencePetrusViitanen1
14 views96 Folien
Company Fashion Show ChemAI 231116.pptx von
Company Fashion Show ChemAI 231116.pptxCompany Fashion Show ChemAI 231116.pptx
Company Fashion Show ChemAI 231116.pptxMarco Tibaldi
69 views30 Folien
Connecting communities to promote FAIR resources: perspectives from an RDA / ... von
Connecting communities to promote FAIR resources: perspectives from an RDA / ...Connecting communities to promote FAIR resources: perspectives from an RDA / ...
Connecting communities to promote FAIR resources: perspectives from an RDA / ...Allyson Lister
31 views49 Folien
A training, certification and marketing scheme for informal dairy vendors in ... von
A training, certification and marketing scheme for informal dairy vendors in ...A training, certification and marketing scheme for informal dairy vendors in ...
A training, certification and marketing scheme for informal dairy vendors in ...ILRI
8 views13 Folien
Guinea Pig as a Model for Translation Research von
Guinea Pig as a Model for Translation ResearchGuinea Pig as a Model for Translation Research
Guinea Pig as a Model for Translation ResearchPervaizDar1
11 views21 Folien

Último(20)

domestic waste_100013.pptx von padmasriv25
domestic waste_100013.pptxdomestic waste_100013.pptx
domestic waste_100013.pptx
padmasriv2510 views
Company Fashion Show ChemAI 231116.pptx von Marco Tibaldi
Company Fashion Show ChemAI 231116.pptxCompany Fashion Show ChemAI 231116.pptx
Company Fashion Show ChemAI 231116.pptx
Marco Tibaldi69 views
Connecting communities to promote FAIR resources: perspectives from an RDA / ... von Allyson Lister
Connecting communities to promote FAIR resources: perspectives from an RDA / ...Connecting communities to promote FAIR resources: perspectives from an RDA / ...
Connecting communities to promote FAIR resources: perspectives from an RDA / ...
Allyson Lister31 views
A training, certification and marketing scheme for informal dairy vendors in ... von ILRI
A training, certification and marketing scheme for informal dairy vendors in ...A training, certification and marketing scheme for informal dairy vendors in ...
A training, certification and marketing scheme for informal dairy vendors in ...
ILRI8 views
Guinea Pig as a Model for Translation Research von PervaizDar1
Guinea Pig as a Model for Translation ResearchGuinea Pig as a Model for Translation Research
Guinea Pig as a Model for Translation Research
PervaizDar111 views
Conventional and non-conventional methods for improvement of cucurbits.pptx von gandhi976
Conventional and non-conventional methods for improvement of cucurbits.pptxConventional and non-conventional methods for improvement of cucurbits.pptx
Conventional and non-conventional methods for improvement of cucurbits.pptx
gandhi97614 views
Open Access Publishing in Astrophysics von Peter Coles
Open Access Publishing in AstrophysicsOpen Access Publishing in Astrophysics
Open Access Publishing in Astrophysics
Peter Coles380 views
MODULE-9-Biotechnology, Genetically Modified Organisms, and Gene Therapy.pdf von KerryNuez1
MODULE-9-Biotechnology, Genetically Modified Organisms, and Gene Therapy.pdfMODULE-9-Biotechnology, Genetically Modified Organisms, and Gene Therapy.pdf
MODULE-9-Biotechnology, Genetically Modified Organisms, and Gene Therapy.pdf
KerryNuez119 views
Max Welling ChemAI 231116.pptx von Marco Tibaldi
Max Welling ChemAI 231116.pptxMax Welling ChemAI 231116.pptx
Max Welling ChemAI 231116.pptx
Marco Tibaldi132 views
Workshop LLM Life Sciences ChemAI 231116.pptx von Marco Tibaldi
Workshop LLM Life Sciences ChemAI 231116.pptxWorkshop LLM Life Sciences ChemAI 231116.pptx
Workshop LLM Life Sciences ChemAI 231116.pptx
Marco Tibaldi96 views
Artificial Intelligence Helps in Drug Designing and Discovery.pptx von abhinashsahoo2001
Artificial Intelligence Helps in Drug Designing and Discovery.pptxArtificial Intelligence Helps in Drug Designing and Discovery.pptx
Artificial Intelligence Helps in Drug Designing and Discovery.pptx
abhinashsahoo2001112 views
Physical Characterization of Moon Impactor WE0913A von Sérgio Sacani
Physical Characterization of Moon Impactor WE0913APhysical Characterization of Moon Impactor WE0913A
Physical Characterization of Moon Impactor WE0913A
Sérgio Sacani42 views
"How can I develop my learning path in bioinformatics? von Bioinformy
"How can I develop my learning path in bioinformatics?"How can I develop my learning path in bioinformatics?
"How can I develop my learning path in bioinformatics?
Bioinformy17 views
PRINCIPLES-OF ASSESSMENT von rbalmagro
PRINCIPLES-OF ASSESSMENTPRINCIPLES-OF ASSESSMENT
PRINCIPLES-OF ASSESSMENT
rbalmagro9 views

Avacta Life Sciences Affimers Presentation Global Protein Engineering Summit (PEGS)

  • 1. Biological Recognition: Beyond the Antibody Paul Ko Ferrigno Chief Scientific Officer
  • 2. This talk • Antibodies and the need for new scaffolds • Historical perspective- scaffolds • Next generation scaffolds- design considerations • Affimer performance
  • 3. Biological Recognition- Antibodies Antibodies • Are fantastic diagnostic tools • Are pretty good reagents for research • Can be made to be good drugs Why? • Optimisation • Large binding surface area • Constant region allows generic protocols
  • 4. But antibodies… • Can suffer from cross-reactivity • Can be difficult to express • Can be difficult to engineer • Can be difficult to use • Generating a functional binder for each element of proteome is a huge challenge
  • 5. What we need to do- Human Protein Atlas Berglund et al (2008) Proteomics 2008, 8, 2832–2839
  • 6. Validation score Validation category Criteria Number of antibodies Fraction % 1. High Supportive Two independent antibodies with similar staining pattern consistent with experimental and/or bioinformatics data 687 7 2. Medium Supportive Staining pattern consistent with experimental and/or bioinformatics data 1414 15 3. Low Uncertain Staining pattern partly consistent with experimental and/or bioinformatics data 1853 20 4. Very low Uncertain No literature or bioinformatics data available 861 9 5. Failed Failed Staining pattern not consistent with experimental and/or bioinformatics data 4543 49 Where we are- Catalogue reagents and HPA TABLE II Validation of 9358 internally generated antibodies Berglund et al (2008) A Genecentric Human Protein Atlas for Expression Profiles Based on Antibodies. Molecular & Cellular Proteomics, 7, 2019-2027. 5436 external antibodies from 51 different antibody providers were obtained and subsequently validated. Of these, 1410 monoclo nal antibodies and 1316 polyclonal antibodies were approved by a standardized validation using Western blotting and IHC on tissue microarrays as described above. The success rates (…) showed (…) an average success rate of 49%.
  • 7. If half of all research antibodies tested fail… Research: huge amount of time wasted in finding the right reagent Proteomics: limited coverage, limited understanding Pharma: new target, but no tools= no assays = no drugs
  • 8. First Gen Scaffolds Binz, Amstutz & Plückthun, Nature Biotech 23, 1257 - 1268 (2005)
  • 9. Why do we need more scaffolds? • Early scaffolds started as academic research projects • Later ‘fit for purposes’ scaffolds may rely on untested assumptions • Purpose may dictate scaffold choice-but what happens if the experimental paradigm changes? • Multiplexing represents unique challenges, but is needed for personalised medicine/CDx
  • 10. Next Gen Scaffolds A successful non-Ab scaffold protein should be: (1) of known structure: informed choice of the site for peptide insertion or replacement (2) stable: to constrain the folding of a broad range of peptides (3) flexible: folding not affected by peptide inserts (4) biologically neutral: lacking interactions with irrelevant proteins (5) well-expressed in prokaryotic and eukaryotic environments, data obtained in one system informs experiments performed in the other Woodman et al, J Mol Biol, 2005
  • 11. Woodman et al, J Mol Biol, 2005 Affimers start from a robust, neutral and versatile scaffold Small- 98 aa Lysosomal resident Protease inhibitor No cys Well understood interaction surfaces: very similar to Ab Capable of 1 fM KD
  • 12. Affimers are robust to extremes of pH
  • 13. wavelength (nm) Peptide presentation and protein yields 100 50 0 200 SQM SQT
  • 14. Affimers: non-antibody binding proteins derived from Stefin A Multiple libraries CIS display: 10 12 Phage display: 10 10 Y2H: >10 8 Microarray: >10 4
  • 15. Speed of Screening ka (1/Ms) kd (1/s) Rmax (RU) RI (RU) Conc of analyte KA (1/M) KD (M) Req (RU) kobs (1/s) Chi2 6.76e3 2.15e-5 44.1 -1.28 1000n 3.15e8 3.18e-9 44 6.78e-3 0.0331 0 0.5 1 1.5 2 2.5 2.50 1.25 0.63 0.31 0.16 0.08 0.04 0 AbsorbanceOD480nm Coat Concentration (µg/mL) Direct ELISA of Ψ F6 against Human Recombinant Procalcitonin No Ψ Ψ F6 Binders generated in 7 weeks. LOD ~ 0.16 μg PCL /mL in a non-signal amplified direct ELISA. Biacore trace Kd= 3 nM
  • 16. Baseline ELISA- No signal amplification 1:1:1 binding between Target, Affimer and Secondary 0 0.2 0.4 0.6 0.8 1 1.2 1.4 1.6 1.8 0 0.2 0.4 0.6 0.8 1 1.2 1.4 AbsorbanceOD450nm Target Coating Concentration (μg/mL) Direct ELISA against TargetX with ΨE3 Gal7 ΨE3 Secondary Control 0 0.1 0.2 0.3 0.4 0.5 0.6 0.7 0 0.2 0.4 0.6 0.8 1 1.2 1.4 AbsorbanceOD450nm Target Coating Concentration (μg/mL) Direct ELISA against IL-2 with 2 Ψ's IL-2 ΨA3 IL-2 ΨF3 Secondary Control 0 0.2 0.4 0.6 0.8 1 1.2 1.4 1.6 1.8 2 0 0.2 0.4 0.6 0.8 1 1.2 1.4 AbsorbanceOD450nm Target Coating Concentration (μg/mL) Direct ELISA against IL-6 with ΨA7 IL-6 ΨA7 Secondary Control X -0.5 0 0.5 1 1.5 2 2.5 3 0 0.2 0.4 0.6 0.8 1 1.2 1.4 Absorbance(450-620nm) Antibody coat concentration (μg/mL) Anti-rabbit IgG Affimer D1 is highly specific rIgG mIgG1 mIgG2a mIgG2b mIgG3 rat IgG donkey IgG sheep IgG chicken IgG goat IgG mouse IgM canine IgG
  • 17. Western Blotting Anti-SAA Clone E12 Lysate Lanes 1, 4 & 7 – Life Tech SeeBlue Plus 2 Marker, 5μl Lanes 2, 5 & 8 – HeLa RIPA lysate, 10 μg, reduced Lanes 3, 6 & 9 – Recombinant SAA, 0.1 μg, reduced Binder Lanes 1, 2 & 3 – Anti-SAA Ψ, 0.5 μg/ml Lanes 4, 5 & 6 – Anti-SAA Ψ, 5 μg/ml Lanes 7, 8 & 9 – No binder Detection All Lanes – ab1187 anti-6xHis Rabbit Polyclonal, HRP conjugated, 1/5000
  • 18. Affimers to Small Molecules 0 0.2 0.4 0.6 0.8 1 1.2 1 2 3 4 5 6 7 8 AbsorbanceOD480nm Clone ID Phage ELISA of candidate Posaconazole binders from a screen Posaconazole+Linker Posaconazole+Linker & Free Posaconazole Posaconazole+Linker & Free Voriconazole No Coat Control Posaconazole Voriconazole
  • 19. Isoform Specificity and Intracellular Use inactive active p85 regulates p110 lipid kinase activity via its SH2 domain. In the presence of a p85 SH2 binding protein the inhibition is released, activating p110 Active p110 inhibits phosphorylation of Akt
  • 20. Isoform Specificity and Intracellular Use Binders were generated to the SH2 domains of PI3K subunits. PI3K p85A N-term PI3K p85B N-term PI3K p55G N-term consensus PI3K p85A N-term PI3K p85B N-term PI3K p55G N-term consensus 0 0.2 0.4 0.6 0.8 1 1.2 1.4 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 AbsorbanceOD450nm Clone ID p85A C p85A N p85B C p85B N p55G C p55G N control Phage ELISA results of a screen against the PI3K P85A N-terminal SH2 domain
  • 21. Isoform Specificity and Intracellular Use Candidate Affimers were expressed in 3T3 cells and shown to increase pAKT. Inhibition does not correlate with expression level ie some Affimers are more potent
  • 22. Affimer Arrays for Protein Detection 25,000 features LLOD currently pg/mL in human serum
  • 23. Signatures of Drug Action - DMSO 0.5 1 2 4 hours Staurosporine Up-regulated Down-regulated Panel A: Cells treated with staurosporine undergo apoptosis. A B Panel C: highlights of some of the 336 other Affimers also gave altered signals- some proteins decreasing (probably representin g proteins cleaved in apoptosis) while others are increasing (po ssibly reflecting the detection of cleaved products) Panel B: At 4 hours, after treatment with drug or carrier (DMSO) cells were lysed and proteins fluorescently labelled with Cy3 or C y5. 17k Arrays were challenged with a mixture of these labelled l ysates. Affimers binding proteins such as BAD, known to be incre ased in apoptosis, showed increased signals from cells treated wi th staurosporine. Affimers recognising proteins cleaved in apopt osis, such as CDK2, showed decreased signals. Affimers binding B CL6, a protein whose levels have not been investigated in apopto sis, suggest this protein is down-regulated.
  • 24. Sumoylation Yeast-SUMO-_smt3_ MSESPSANISDADKSAITPTTGDTSQQDVKPSTEHINLKVVGQDNNEVFFKIKKTTEFSK Human-SUMO1 --------MSDQEAKPSTEDLGD------KKEGEYIKLKVIGQDSSEIHFKVKMTTHLKK Human-SUMO2 --------MADEKPKEGVKTENN----------DHINLKVAGQDGSVVQFKIKRHTPLSK ::* . . . .: ::*:*** ***.. : **:* * :.* Yeast-SUMO-_smt3_ LMKIYCARQGKSMNSLRFLVDGERIRPDQTPAELDMEDGDQIEAVLEQLGGCTHLCL Human-SUMO1 LKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV-- Human-SUMO2 LMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY---- * : ** *** .*..:** .:*: * .** :* **: * *:. :* **
  • 25. Yeast SUMO binders and Species Specificity ITC: Ψ-Clone 10 Ψ-Clone 10 Ψ-Clone 15 Ψ-Clone 19 Ψ-Clone 22 YeastSUMO HumanSUMO1 HumanSUMO2 Ψ-Clone10 Ψ-Clone15 Ψ-Clone19 Ψ-Clone22 control Yeast SUMO Human SUMO1 Human SUMO2 AbsorbanceOD480nm 0 0.5 1.0 1.5 Binders were generated that were specific to yeast SUMO. Data shown are direct ELISA and western blot results for 4 candidates against yeast SUMO and human SUMO 1 & 2. ITC for one candidate shows a Kd of ~30 nM.
  • 26. Summary • Affimers are small, robust and versatile proteins • The scaffold has been engineered to lack partners in human systems • Very large libraries can be quickly screened against a broad range of targets • The resulting binders are high affinity and exquisitely specific
  • 27. Acknowledgments Screening/Validation Christina Räuber Laura Dicker Davinia Fernandez Rob Ford Lindsay McMorran Protein Expression Paul Shadbolt Emma Branson Amanda Evans Katarzyna Gorczak Tony Kwok Ruth Lunn Graham Spence Affimer Arrays Kit-Yee Tan Vincent Puard University of Leeds Mike McPherson Darren Tomlinson Christian Tiede Anna Tang Presentation by Paul Ko Ferringo Head of R&D: Matt Johnson For more info visit Avacta Life Sciences or contact chris.miller@avacta.com

Hinweis der Redaktion

  1. Mine Ensemble - look for 50-150 long aa stretches “unique” to each predicted ORF (eg <60% sequence identifity, or with <10 aa stretches of identity to another protein) Express, Make polyclonal QUALITY CONTROL: IHC, PrEST, Array, Western, IF
  2. Titraton elisa direct target is coated on plate, conc of affimer is fixed at 2 µg/ml, detection with anti-his-HRP conjugated, 1:1 binding sub ug/ml detecion in the worst oossible format
  3. We also have binders specific for: P85 b n P85 a n term 85 b term N tem of all 3 P85 a n p55 g n term but not p85 b n term