SlideShare ist ein Scribd-Unternehmen logo
1 von 30
Development of Biomarkers for Stress in Octopus Rachel Thompson School of Aquatic and Fishery Sciences May 15, 2009
Background ,[object Object],[object Object],[object Object],[object Object],Giant Pacific Octopus ( E. dofleini ) Red Octopus ( O. rubescens )
Objectives ,[object Object],[object Object],[object Object],[object Object],[object Object]
Non-Invasive Techniques ,[object Object],[object Object],[object Object],[object Object]
Objectives ,[object Object],[object Object],[object Object],[object Object],[object Object]
Protein Gel Electrophoresis ,[object Object],[object Object],[object Object],[object Object],Container Underwater Skin
Protein Identification ,[object Object],[object Object]
Mass Spectroscopy ,[object Object],[object Object],[object Object],Description Sequence (P02662) Alpha-S1-casein precursor YLGYLEQ (P02662) Alpha-S1-casein precursor EPMIGVNQELAYFYPELFR (P02808) Statherin precursor RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF (P81605) Dermicidin precursor [Contains: Survival-promoting peptide; DCD-1] DAVEDLESVGK
Proteins Isolated from Mucus ,[object Object],[object Object],[object Object],[object Object]
Objectives ,[object Object],[object Object],[object Object],[object Object],[object Object]
Heat Shock Proteins ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Western Blot - HSP 70 ,[object Object],[object Object],[object Object],[object Object]
Objectives ,[object Object],[object Object],[object Object],[object Object],[object Object]
Behavior Monitoring   ,[object Object],[object Object],[object Object],Cephcam watch ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Behavior Observations ,[object Object],[object Object]
Objectives ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Egg Development Laid January, 2009 Refrain from imposing stressful conditions
Observation of Developmental Stages Early: 8 weeks
Late: 12 weeks - Appearance of  chromatophores - Movement within egg
 
Egg Development ,[object Object],[object Object],[object Object],[object Object]
Developmental Genes ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Real-Time PCR (qPCR) ,[object Object],[object Object],[object Object]
Orthodenticle-like protein (OTX) -Expressed early in development  -100,000 fold increase over time
Hedgehog (Hh) -Expressed later in development <100 fold increase over time
Results-Gene Expression ,[object Object],[object Object],[object Object],[object Object],[object Object]
Behavior Observations Prior to Egg-Laying Post Egg-Laying
Summary ,[object Object],[object Object],[object Object],[object Object]
Applications and Future Work ,[object Object],[object Object],[object Object]
Acknowledgements ,[object Object],[object Object],[object Object],[object Object]

Weitere ähnliche Inhalte

Was ist angesagt?

13 4 applications of genetic engineering
13 4 applications of genetic engineering13 4 applications of genetic engineering
13 4 applications of genetic engineering
arislantern
 
Genetics By Swati & Sheela
Genetics By Swati & SheelaGenetics By Swati & Sheela
Genetics By Swati & Sheela
subzero64
 
Genetic Engineering Powerpoint
Genetic Engineering PowerpointGenetic Engineering Powerpoint
Genetic Engineering Powerpoint
MrG
 
Genetic engineering oral
Genetic engineering oralGenetic engineering oral
Genetic engineering oral
Damien512
 
Genetic Engineering
Genetic EngineeringGenetic Engineering
Genetic Engineering
guestb995763
 
Genetic Engineering
Genetic EngineeringGenetic Engineering
Genetic Engineering
Damien512
 
Biotechnology and1 genetic engineering
Biotechnology and1 genetic engineeringBiotechnology and1 genetic engineering
Biotechnology and1 genetic engineering
mandalina landy
 

Was ist angesagt? (20)

13 4 applications of genetic engineering
13 4 applications of genetic engineering13 4 applications of genetic engineering
13 4 applications of genetic engineering
 
Genetics By Swati & Sheela
Genetics By Swati & SheelaGenetics By Swati & Sheela
Genetics By Swati & Sheela
 
Genetic Engineering ppt
Genetic Engineering pptGenetic Engineering ppt
Genetic Engineering ppt
 
Transgenic animal prof.a.k.saha
Transgenic animal prof.a.k.sahaTransgenic animal prof.a.k.saha
Transgenic animal prof.a.k.saha
 
Building a Community Cyberinfrastructure to Support Marine Microbial Ecology ...
Building a Community Cyberinfrastructure to Support Marine Microbial Ecology ...Building a Community Cyberinfrastructure to Support Marine Microbial Ecology ...
Building a Community Cyberinfrastructure to Support Marine Microbial Ecology ...
 
Cross-Kingdom Standards in Genomics, Epigenomics and Metagenomics
Cross-Kingdom Standards in Genomics, Epigenomics and MetagenomicsCross-Kingdom Standards in Genomics, Epigenomics and Metagenomics
Cross-Kingdom Standards in Genomics, Epigenomics and Metagenomics
 
2 chapter 5 genes and chromosome
2 chapter 5   genes and chromosome2 chapter 5   genes and chromosome
2 chapter 5 genes and chromosome
 
Epigenetic and Environmental Influences on the Shellfish Immune Response
Epigenetic and Environmental Influences on the Shellfish Immune ResponseEpigenetic and Environmental Influences on the Shellfish Immune Response
Epigenetic and Environmental Influences on the Shellfish Immune Response
 
Future of technology
Future of technologyFuture of technology
Future of technology
 
Transgenic animal models &amp; their
Transgenic animal models &amp; theirTransgenic animal models &amp; their
Transgenic animal models &amp; their
 
Genetic Engineering Powerpoint
Genetic Engineering PowerpointGenetic Engineering Powerpoint
Genetic Engineering Powerpoint
 
Genetic engineering oral
Genetic engineering oralGenetic engineering oral
Genetic engineering oral
 
Transgenic animals
Transgenic animalsTransgenic animals
Transgenic animals
 
Genetic engineering in animal
Genetic engineering in animalGenetic engineering in animal
Genetic engineering in animal
 
Genetic engineerig
Genetic engineerigGenetic engineerig
Genetic engineerig
 
Genetic Engineering
Genetic EngineeringGenetic Engineering
Genetic Engineering
 
Transgenic Talk
Transgenic TalkTransgenic Talk
Transgenic Talk
 
Genetic Engineering
Genetic EngineeringGenetic Engineering
Genetic Engineering
 
Biotechnology and1 genetic engineering
Biotechnology and1 genetic engineeringBiotechnology and1 genetic engineering
Biotechnology and1 genetic engineering
 
Nanopore long-read metagenomics
Nanopore long-read metagenomicsNanopore long-read metagenomics
Nanopore long-read metagenomics
 

Ähnlich wie Thompson_MGpresentation

Jonathan Lendrum, Dean's Distinguished Research Fellowship Application
Jonathan Lendrum, Dean's Distinguished Research Fellowship ApplicationJonathan Lendrum, Dean's Distinguished Research Fellowship Application
Jonathan Lendrum, Dean's Distinguished Research Fellowship Application
Jon Lendrum
 
Don't Miss a Beat: Understanding Continuous, Real Time Physiologic Monitoring
Don't Miss a Beat:  Understanding Continuous, Real Time Physiologic MonitoringDon't Miss a Beat:  Understanding Continuous, Real Time Physiologic Monitoring
Don't Miss a Beat: Understanding Continuous, Real Time Physiologic Monitoring
InsideScientific
 
Genetic proclivities of two-component modulated aerobiosis
Genetic proclivities of two-component modulated aerobiosisGenetic proclivities of two-component modulated aerobiosis
Genetic proclivities of two-component modulated aerobiosis
Tijani Hamzat Ibiyeye
 

Ähnlich wie Thompson_MGpresentation (20)

Dr. Rebecca Pentecost: Pennsylvania Llama and Alpaca Association 2011
Dr. Rebecca Pentecost: Pennsylvania Llama and Alpaca Association 2011 Dr. Rebecca Pentecost: Pennsylvania Llama and Alpaca Association 2011
Dr. Rebecca Pentecost: Pennsylvania Llama and Alpaca Association 2011
 
Rebecca Pentecost DVM: PLAA 2011 Keynote Slides
Rebecca Pentecost DVM: PLAA 2011 Keynote SlidesRebecca Pentecost DVM: PLAA 2011 Keynote Slides
Rebecca Pentecost DVM: PLAA 2011 Keynote Slides
 
General biology-2-module-1-answers
General biology-2-module-1-answersGeneral biology-2-module-1-answers
General biology-2-module-1-answers
 
Host Cell Proteins
Host Cell ProteinsHost Cell Proteins
Host Cell Proteins
 
Host Cell Proteins
Host Cell ProteinsHost Cell Proteins
Host Cell Proteins
 
Jonathan Lendrum, Dean's Distinguished Research Fellowship Application
Jonathan Lendrum, Dean's Distinguished Research Fellowship ApplicationJonathan Lendrum, Dean's Distinguished Research Fellowship Application
Jonathan Lendrum, Dean's Distinguished Research Fellowship Application
 
Neurons in the Medulla Oblongata Related to Gastric Mucosal Lesion of Rats Su...
Neurons in the Medulla Oblongata Related to Gastric Mucosal Lesion of Rats Su...Neurons in the Medulla Oblongata Related to Gastric Mucosal Lesion of Rats Su...
Neurons in the Medulla Oblongata Related to Gastric Mucosal Lesion of Rats Su...
 
screening model for Parkinson's disease.pptx
screening model for Parkinson's disease.pptxscreening model for Parkinson's disease.pptx
screening model for Parkinson's disease.pptx
 
Don't Miss a Beat: Understanding Continuous, Real Time Physiologic Monitoring
Don't Miss a Beat:  Understanding Continuous, Real Time Physiologic MonitoringDon't Miss a Beat:  Understanding Continuous, Real Time Physiologic Monitoring
Don't Miss a Beat: Understanding Continuous, Real Time Physiologic Monitoring
 
Lecture 1 Introduction to Bioinformatics BCH 433.ppt
Lecture 1 Introduction to Bioinformatics BCH 433.pptLecture 1 Introduction to Bioinformatics BCH 433.ppt
Lecture 1 Introduction to Bioinformatics BCH 433.ppt
 
Poster
PosterPoster
Poster
 
High-throughput Sequencing Analysis and Function Prediction of Lung Microbiot...
High-throughput Sequencing Analysis and Function Prediction of Lung Microbiot...High-throughput Sequencing Analysis and Function Prediction of Lung Microbiot...
High-throughput Sequencing Analysis and Function Prediction of Lung Microbiot...
 
Genetic proclivities of two-component modulated aerobiosis
Genetic proclivities of two-component modulated aerobiosisGenetic proclivities of two-component modulated aerobiosis
Genetic proclivities of two-component modulated aerobiosis
 
Biotechnology.pptx
Biotechnology.pptxBiotechnology.pptx
Biotechnology.pptx
 
Galvao MOL et al 2009
Galvao MOL et al 2009Galvao MOL et al 2009
Galvao MOL et al 2009
 
Galvao MOL et al 2009
Galvao MOL et al 2009Galvao MOL et al 2009
Galvao MOL et al 2009
 
Npy
NpyNpy
Npy
 
Npy final paper
Npy final paperNpy final paper
Npy final paper
 
Npy final paper
Npy final paperNpy final paper
Npy final paper
 
Varney_2015
Varney_2015Varney_2015
Varney_2015
 

Mehr von sr320

Genomics on the Half Shell: Making Science more Open
Genomics on the Half Shell: Making Science more OpenGenomics on the Half Shell: Making Science more Open
Genomics on the Half Shell: Making Science more Open
sr320
 
FISH441: Oysters, acidification and methylation
FISH441: Oysters, acidification and methylationFISH441: Oysters, acidification and methylation
FISH441: Oysters, acidification and methylation
sr320
 
FISH441 Group Project (Oysters)
FISH441 Group Project (Oysters)FISH441 Group Project (Oysters)
FISH441 Group Project (Oysters)
sr320
 
Timmins-Schiffman P2010
Timmins-Schiffman P2010Timmins-Schiffman P2010
Timmins-Schiffman P2010
sr320
 
Gavery PCSGA 2010
Gavery PCSGA 2010Gavery PCSGA 2010
Gavery PCSGA 2010
sr320
 

Mehr von sr320 (20)

Identifying Local Olympia Oyster Stocks Useful for Restoration
Identifying Local Olympia Oyster Stocks Useful for RestorationIdentifying Local Olympia Oyster Stocks Useful for Restoration
Identifying Local Olympia Oyster Stocks Useful for Restoration
 
Does DNA methylation facilitate phenotypic plasticity in marine invertebrates?
Does DNA methylation facilitate phenotypic plasticity in marine invertebrates?Does DNA methylation facilitate phenotypic plasticity in marine invertebrates?
Does DNA methylation facilitate phenotypic plasticity in marine invertebrates?
 
Science Communication and Impact: A Researcher's Perspective
Science Communication and Impact: A Researcher's PerspectiveScience Communication and Impact: A Researcher's Perspective
Science Communication and Impact: A Researcher's Perspective
 
Genomic approaches to assessing ecosystem health
Genomic approaches to assessing ecosystem healthGenomic approaches to assessing ecosystem health
Genomic approaches to assessing ecosystem health
 
Collaborative Genomic Data Analyses in the Cloud
Collaborative Genomic Data Analyses in the CloudCollaborative Genomic Data Analyses in the Cloud
Collaborative Genomic Data Analyses in the Cloud
 
Genomics on the Half Shell: Making Science more Open
Genomics on the Half Shell: Making Science more OpenGenomics on the Half Shell: Making Science more Open
Genomics on the Half Shell: Making Science more Open
 
NSA2012 Short reads and Oyster Genome Resources
NSA2012 Short reads and Oyster Genome ResourcesNSA2012 Short reads and Oyster Genome Resources
NSA2012 Short reads and Oyster Genome Resources
 
Short read sequencing and shellfish
Short read sequencing and shellfishShort read sequencing and shellfish
Short read sequencing and shellfish
 
FISH441: Oysters, acidification and methylation
FISH441: Oysters, acidification and methylationFISH441: Oysters, acidification and methylation
FISH441: Oysters, acidification and methylation
 
FISH441: Oyster acidification: gene and protein expression
FISH441: Oyster acidification: gene and protein expression FISH441: Oyster acidification: gene and protein expression
FISH441: Oyster acidification: gene and protein expression
 
FISH441: Oyster Hypoxia and acclimation
FISH441: Oyster Hypoxia and acclimationFISH441: Oyster Hypoxia and acclimation
FISH441: Oyster Hypoxia and acclimation
 
Timmins Schiffman PCSGA 2011
Timmins Schiffman PCSGA 2011Timmins Schiffman PCSGA 2011
Timmins Schiffman PCSGA 2011
 
Elene Dorfmeier pcsga11
Elene Dorfmeier pcsga11 Elene Dorfmeier pcsga11
Elene Dorfmeier pcsga11
 
FISH510 Lec 1
FISH510 Lec 1FISH510 Lec 1
FISH510 Lec 1
 
FISH441 Group Project (Oysters)
FISH441 Group Project (Oysters)FISH441 Group Project (Oysters)
FISH441 Group Project (Oysters)
 
Timmins-Schiffman P2010
Timmins-Schiffman P2010Timmins-Schiffman P2010
Timmins-Schiffman P2010
 
Gavery PCSGA 2010
Gavery PCSGA 2010Gavery PCSGA 2010
Gavery PCSGA 2010
 
Salmon Senescence
Salmon SenescenceSalmon Senescence
Salmon Senescence
 
Roberts GRC
Roberts GRCRoberts GRC
Roberts GRC
 
Herring SNP Sneak Peak
Herring SNP Sneak PeakHerring SNP Sneak Peak
Herring SNP Sneak Peak
 

Kürzlich hochgeladen

1029-Danh muc Sach Giao Khoa khoi 6.pdf
1029-Danh muc Sach Giao Khoa khoi  6.pdf1029-Danh muc Sach Giao Khoa khoi  6.pdf
1029-Danh muc Sach Giao Khoa khoi 6.pdf
QucHHunhnh
 
Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...
Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...
Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...
Krashi Coaching
 
Beyond the EU: DORA and NIS 2 Directive's Global Impact
Beyond the EU: DORA and NIS 2 Directive's Global ImpactBeyond the EU: DORA and NIS 2 Directive's Global Impact
Beyond the EU: DORA and NIS 2 Directive's Global Impact
PECB
 
Ecosystem Interactions Class Discussion Presentation in Blue Green Lined Styl...
Ecosystem Interactions Class Discussion Presentation in Blue Green Lined Styl...Ecosystem Interactions Class Discussion Presentation in Blue Green Lined Styl...
Ecosystem Interactions Class Discussion Presentation in Blue Green Lined Styl...
fonyou31
 
The basics of sentences session 2pptx copy.pptx
The basics of sentences session 2pptx copy.pptxThe basics of sentences session 2pptx copy.pptx
The basics of sentences session 2pptx copy.pptx
heathfieldcps1
 

Kürzlich hochgeladen (20)

Mattingly "AI & Prompt Design: The Basics of Prompt Design"
Mattingly "AI & Prompt Design: The Basics of Prompt Design"Mattingly "AI & Prompt Design: The Basics of Prompt Design"
Mattingly "AI & Prompt Design: The Basics of Prompt Design"
 
Unit-IV- Pharma. Marketing Channels.pptx
Unit-IV- Pharma. Marketing Channels.pptxUnit-IV- Pharma. Marketing Channels.pptx
Unit-IV- Pharma. Marketing Channels.pptx
 
INDIA QUIZ 2024 RLAC DELHI UNIVERSITY.pptx
INDIA QUIZ 2024 RLAC DELHI UNIVERSITY.pptxINDIA QUIZ 2024 RLAC DELHI UNIVERSITY.pptx
INDIA QUIZ 2024 RLAC DELHI UNIVERSITY.pptx
 
1029-Danh muc Sach Giao Khoa khoi 6.pdf
1029-Danh muc Sach Giao Khoa khoi  6.pdf1029-Danh muc Sach Giao Khoa khoi  6.pdf
1029-Danh muc Sach Giao Khoa khoi 6.pdf
 
Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...
Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...
Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...
 
Software Engineering Methodologies (overview)
Software Engineering Methodologies (overview)Software Engineering Methodologies (overview)
Software Engineering Methodologies (overview)
 
Disha NEET Physics Guide for classes 11 and 12.pdf
Disha NEET Physics Guide for classes 11 and 12.pdfDisha NEET Physics Guide for classes 11 and 12.pdf
Disha NEET Physics Guide for classes 11 and 12.pdf
 
Beyond the EU: DORA and NIS 2 Directive's Global Impact
Beyond the EU: DORA and NIS 2 Directive's Global ImpactBeyond the EU: DORA and NIS 2 Directive's Global Impact
Beyond the EU: DORA and NIS 2 Directive's Global Impact
 
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
 
A Critique of the Proposed National Education Policy Reform
A Critique of the Proposed National Education Policy ReformA Critique of the Proposed National Education Policy Reform
A Critique of the Proposed National Education Policy Reform
 
SOCIAL AND HISTORICAL CONTEXT - LFTVD.pptx
SOCIAL AND HISTORICAL CONTEXT - LFTVD.pptxSOCIAL AND HISTORICAL CONTEXT - LFTVD.pptx
SOCIAL AND HISTORICAL CONTEXT - LFTVD.pptx
 
Student login on Anyboli platform.helpin
Student login on Anyboli platform.helpinStudent login on Anyboli platform.helpin
Student login on Anyboli platform.helpin
 
Código Creativo y Arte de Software | Unidad 1
Código Creativo y Arte de Software | Unidad 1Código Creativo y Arte de Software | Unidad 1
Código Creativo y Arte de Software | Unidad 1
 
Holdier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdfHoldier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdf
 
Call Girls in Dwarka Mor Delhi Contact Us 9654467111
Call Girls in Dwarka Mor Delhi Contact Us 9654467111Call Girls in Dwarka Mor Delhi Contact Us 9654467111
Call Girls in Dwarka Mor Delhi Contact Us 9654467111
 
APM Welcome, APM North West Network Conference, Synergies Across Sectors
APM Welcome, APM North West Network Conference, Synergies Across SectorsAPM Welcome, APM North West Network Conference, Synergies Across Sectors
APM Welcome, APM North West Network Conference, Synergies Across Sectors
 
Z Score,T Score, Percential Rank and Box Plot Graph
Z Score,T Score, Percential Rank and Box Plot GraphZ Score,T Score, Percential Rank and Box Plot Graph
Z Score,T Score, Percential Rank and Box Plot Graph
 
Ecosystem Interactions Class Discussion Presentation in Blue Green Lined Styl...
Ecosystem Interactions Class Discussion Presentation in Blue Green Lined Styl...Ecosystem Interactions Class Discussion Presentation in Blue Green Lined Styl...
Ecosystem Interactions Class Discussion Presentation in Blue Green Lined Styl...
 
The basics of sentences session 2pptx copy.pptx
The basics of sentences session 2pptx copy.pptxThe basics of sentences session 2pptx copy.pptx
The basics of sentences session 2pptx copy.pptx
 
Q4-W6-Restating Informational Text Grade 3
Q4-W6-Restating Informational Text Grade 3Q4-W6-Restating Informational Text Grade 3
Q4-W6-Restating Informational Text Grade 3
 

Thompson_MGpresentation