SlideShare ist ein Scribd-Unternehmen logo
1 von 23
TUTORIAL  on ROASTING
[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],Roasting
[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Multiple Hearth Roasting ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Pictorial view of multiple hearth roasting unit
Roasting of Zinc sulfide ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Flash Roasting ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Fluidized bed roasting ,[object Object],[object Object],[object Object],[object Object],[object Object]
Fluidized bed Roasting ,[object Object],[object Object],[object Object],[object Object]
[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],Stages observed during roasting process
[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
[object Object],[object Object],[object Object],[object Object],[object Object]
The Fluidization Behaviour
Advantages ,[object Object],[object Object],[object Object],[object Object]
Sinter Roasting / Blast Roasting ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Sintering machine
Lead Roasting ,[object Object],[object Object],[object Object],[object Object],[object Object]
Thank You
 
 
 

Weitere Àhnliche Inhalte

Was ist angesagt?

Principals of roasting and its types
Principals of roasting and its typesPrincipals of roasting and its types
Principals of roasting and its typesAkshat Chaturvedi
 
Ladle Metallurgy: Basics, Objectives and Processes
Ladle Metallurgy: Basics, Objectives and ProcessesLadle Metallurgy: Basics, Objectives and Processes
Ladle Metallurgy: Basics, Objectives and ProcessesElakkiya Mani
 
Steel Making: Lecture 1 Introduction to the subject and review of Iron Making
Steel Making: Lecture 1 Introduction to the subject and review of Iron Making Steel Making: Lecture 1 Introduction to the subject and review of Iron Making
Steel Making: Lecture 1 Introduction to the subject and review of Iron Making NED University of Engineering and Technology
 
Electric arc furnace
Electric arc furnaceElectric arc furnace
Electric arc furnaceGulfam Hussain
 
(Pitting corrosion and crevice corrosion)
(Pitting  corrosion  and crevice  corrosion)(Pitting  corrosion  and crevice  corrosion)
(Pitting corrosion and crevice corrosion)Mustafa Hasan
 
Surface or case hardening
Surface or case hardeningSurface or case hardening
Surface or case hardeningAnuj Jha
 
Electrometallurgy_week 7_8.pdf
Electrometallurgy_week 7_8.pdfElectrometallurgy_week 7_8.pdf
Electrometallurgy_week 7_8.pdfFatimaAzharAzharIqba
 
Refractories and Operation of RH and RH-OB Process
Refractories and Operation of RH and RH-OB ProcessRefractories and Operation of RH and RH-OB Process
Refractories and Operation of RH and RH-OB Processsampad mishra
 
Pelletization of iron ores and the type of wear liners used in thier eqipments
Pelletization of iron ores and the type of wear liners used in thier eqipmentsPelletization of iron ores and the type of wear liners used in thier eqipments
Pelletization of iron ores and the type of wear liners used in thier eqipmentsGulshan Kumar Singh
 
Blast furnace presentation
Blast furnace presentation Blast furnace presentation
Blast furnace presentation Muzzamil Eatoo
 
Steel making
Steel makingSteel making
Steel makingS Gafoor
 
NON FERROUS ALLOYS.
NON FERROUS ALLOYS. NON FERROUS ALLOYS.
NON FERROUS ALLOYS. JadavParth
 
Vacuum Arc Remelting Furnaces in Midhani
Vacuum Arc Remelting Furnaces in MidhaniVacuum Arc Remelting Furnaces in Midhani
Vacuum Arc Remelting Furnaces in MidhaniAmitkumar Singalwar
 
Corrosion of weldments
Corrosion of weldmentsCorrosion of weldments
Corrosion of weldmentssumeet sharma
 
BASIC OXYGEN STEELMAKING (BOS) - The Processing Route (blast furnace - basic ...
BASIC OXYGEN STEELMAKING (BOS) - The Processing Route (blast furnace - basic ...BASIC OXYGEN STEELMAKING (BOS) - The Processing Route (blast furnace - basic ...
BASIC OXYGEN STEELMAKING (BOS) - The Processing Route (blast furnace - basic ...Matteo Sporchia
 

Was ist angesagt? (20)

Principals of roasting and its types
Principals of roasting and its typesPrincipals of roasting and its types
Principals of roasting and its types
 
Ladle Metallurgy: Basics, Objectives and Processes
Ladle Metallurgy: Basics, Objectives and ProcessesLadle Metallurgy: Basics, Objectives and Processes
Ladle Metallurgy: Basics, Objectives and Processes
 
Steel Making: Lecture 1 Introduction to the subject and review of Iron Making
Steel Making: Lecture 1 Introduction to the subject and review of Iron Making Steel Making: Lecture 1 Introduction to the subject and review of Iron Making
Steel Making: Lecture 1 Introduction to the subject and review of Iron Making
 
Electric arc furnace
Electric arc furnaceElectric arc furnace
Electric arc furnace
 
(Pitting corrosion and crevice corrosion)
(Pitting  corrosion  and crevice  corrosion)(Pitting  corrosion  and crevice  corrosion)
(Pitting corrosion and crevice corrosion)
 
Surface or case hardening
Surface or case hardeningSurface or case hardening
Surface or case hardening
 
Blast furnace
Blast furnaceBlast furnace
Blast furnace
 
Electrometallurgy_week 7_8.pdf
Electrometallurgy_week 7_8.pdfElectrometallurgy_week 7_8.pdf
Electrometallurgy_week 7_8.pdf
 
Refining Slags.pptx
Refining Slags.pptxRefining Slags.pptx
Refining Slags.pptx
 
Refractories and Operation of RH and RH-OB Process
Refractories and Operation of RH and RH-OB ProcessRefractories and Operation of RH and RH-OB Process
Refractories and Operation of RH and RH-OB Process
 
Pelletization of iron ores and the type of wear liners used in thier eqipments
Pelletization of iron ores and the type of wear liners used in thier eqipmentsPelletization of iron ores and the type of wear liners used in thier eqipments
Pelletization of iron ores and the type of wear liners used in thier eqipments
 
Corrosion & its control measures
Corrosion & its control measuresCorrosion & its control measures
Corrosion & its control measures
 
Electric Arc furnace
Electric Arc furnaceElectric Arc furnace
Electric Arc furnace
 
Blast furnace presentation
Blast furnace presentation Blast furnace presentation
Blast furnace presentation
 
Steel making
Steel makingSteel making
Steel making
 
Steel Making: Lecture open hearth furnace
Steel Making: Lecture open hearth furnaceSteel Making: Lecture open hearth furnace
Steel Making: Lecture open hearth furnace
 
NON FERROUS ALLOYS.
NON FERROUS ALLOYS. NON FERROUS ALLOYS.
NON FERROUS ALLOYS.
 
Vacuum Arc Remelting Furnaces in Midhani
Vacuum Arc Remelting Furnaces in MidhaniVacuum Arc Remelting Furnaces in Midhani
Vacuum Arc Remelting Furnaces in Midhani
 
Corrosion of weldments
Corrosion of weldmentsCorrosion of weldments
Corrosion of weldments
 
BASIC OXYGEN STEELMAKING (BOS) - The Processing Route (blast furnace - basic ...
BASIC OXYGEN STEELMAKING (BOS) - The Processing Route (blast furnace - basic ...BASIC OXYGEN STEELMAKING (BOS) - The Processing Route (blast furnace - basic ...
BASIC OXYGEN STEELMAKING (BOS) - The Processing Route (blast furnace - basic ...
 

Andere mochten auch

Tutorial on roasting furnaces s.d.kahar
Tutorial on roasting furnaces s.d.kaharTutorial on roasting furnaces s.d.kahar
Tutorial on roasting furnaces s.d.kaharM S University of Baroda
 
Unit Process of Extraction Lecture Notes
Unit Process of Extraction Lecture NotesUnit Process of Extraction Lecture Notes
Unit Process of Extraction Lecture NotesFellowBuddy.com
 
Stages of hydrometallurgical processes
Stages of hydrometallurgical processesStages of hydrometallurgical processes
Stages of hydrometallurgical processesreyhane mazahernasab
 
Diagramas de Kellogg (Diagramas de predominancia)
Diagramas de Kellogg (Diagramas de predominancia)Diagramas de Kellogg (Diagramas de predominancia)
Diagramas de Kellogg (Diagramas de predominancia)costafro
 
Leaching process (solid-liquid extraction)
Leaching process (solid-liquid extraction)Leaching process (solid-liquid extraction)
Leaching process (solid-liquid extraction)Asim Farooq
 
Mitigating acrylamide in chicorea using fluorescence
Mitigating acrylamide in chicorea using fluorescenceMitigating acrylamide in chicorea using fluorescence
Mitigating acrylamide in chicorea using fluorescenceSpectralysInnovation
 
Summer Training report of Hindustan Zinc limited
Summer Training report of Hindustan Zinc limitedSummer Training report of Hindustan Zinc limited
Summer Training report of Hindustan Zinc limitedAkhil Sodani
 
ppt project
ppt projectppt project
ppt projectSRIJAN ROY
 
Iea bioenergy t32_torrefaction_review (overview of technologies)
Iea bioenergy t32_torrefaction_review (overview of technologies)Iea bioenergy t32_torrefaction_review (overview of technologies)
Iea bioenergy t32_torrefaction_review (overview of technologies)drs. ing. George van Bommel MBE, BSc
 
Fluidized bed introduction by mohabat ali malik(MUET,jamshoro)
Fluidized bed introduction by mohabat ali malik(MUET,jamshoro)Fluidized bed introduction by mohabat ali malik(MUET,jamshoro)
Fluidized bed introduction by mohabat ali malik(MUET,jamshoro)mohabat_ali
 
TOOL STEELS & THEIR HEAT TREATMENT
TOOL STEELS & THEIR HEAT TREATMENTTOOL STEELS & THEIR HEAT TREATMENT
TOOL STEELS & THEIR HEAT TREATMENTSWAPNIL NIGAM
 
Extractive Metallurgy Presentation (Zinc)
Extractive Metallurgy Presentation (Zinc)Extractive Metallurgy Presentation (Zinc)
Extractive Metallurgy Presentation (Zinc)Abhijeet Singh
 
Time bio n chem
Time bio n chemTime bio n chem
Time bio n chemvidoush
 

Andere mochten auch (20)

Tutorial on roasting furnaces s.d.kahar
Tutorial on roasting furnaces s.d.kaharTutorial on roasting furnaces s.d.kahar
Tutorial on roasting furnaces s.d.kahar
 
Unit Process of Extraction Lecture Notes
Unit Process of Extraction Lecture NotesUnit Process of Extraction Lecture Notes
Unit Process of Extraction Lecture Notes
 
Stages of hydrometallurgical processes
Stages of hydrometallurgical processesStages of hydrometallurgical processes
Stages of hydrometallurgical processes
 
Diagramas de Kellogg (Diagramas de predominancia)
Diagramas de Kellogg (Diagramas de predominancia)Diagramas de Kellogg (Diagramas de predominancia)
Diagramas de Kellogg (Diagramas de predominancia)
 
Leaching process (solid-liquid extraction)
Leaching process (solid-liquid extraction)Leaching process (solid-liquid extraction)
Leaching process (solid-liquid extraction)
 
Mitigating acrylamide in chicorea using fluorescence
Mitigating acrylamide in chicorea using fluorescenceMitigating acrylamide in chicorea using fluorescence
Mitigating acrylamide in chicorea using fluorescence
 
Ozone
OzoneOzone
Ozone
 
Summer Training report of Hindustan Zinc limited
Summer Training report of Hindustan Zinc limitedSummer Training report of Hindustan Zinc limited
Summer Training report of Hindustan Zinc limited
 
Nylon 6
Nylon 6Nylon 6
Nylon 6
 
Ellingham diagram
Ellingham diagramEllingham diagram
Ellingham diagram
 
ppt project
ppt projectppt project
ppt project
 
Iea bioenergy t32_torrefaction_review (overview of technologies)
Iea bioenergy t32_torrefaction_review (overview of technologies)Iea bioenergy t32_torrefaction_review (overview of technologies)
Iea bioenergy t32_torrefaction_review (overview of technologies)
 
Ozone
OzoneOzone
Ozone
 
Fluidized bed introduction by mohabat ali malik(MUET,jamshoro)
Fluidized bed introduction by mohabat ali malik(MUET,jamshoro)Fluidized bed introduction by mohabat ali malik(MUET,jamshoro)
Fluidized bed introduction by mohabat ali malik(MUET,jamshoro)
 
Nylon 6
Nylon 6Nylon 6
Nylon 6
 
TOOL STEELS & THEIR HEAT TREATMENT
TOOL STEELS & THEIR HEAT TREATMENTTOOL STEELS & THEIR HEAT TREATMENT
TOOL STEELS & THEIR HEAT TREATMENT
 
Extractive Metallurgy Presentation (Zinc)
Extractive Metallurgy Presentation (Zinc)Extractive Metallurgy Presentation (Zinc)
Extractive Metallurgy Presentation (Zinc)
 
La tostaciĂłn en pirometalurgia
La tostaciĂłn en pirometalurgiaLa tostaciĂłn en pirometalurgia
La tostaciĂłn en pirometalurgia
 
Leaching
LeachingLeaching
Leaching
 
Time bio n chem
Time bio n chemTime bio n chem
Time bio n chem
 

Ähnlich wie Tutorial on roasting furnaces final

extraction of Fe and Cu metals from their ores , alloys
extraction of Fe and Cu metals from their ores , alloysextraction of Fe and Cu metals from their ores , alloys
extraction of Fe and Cu metals from their ores , alloysAnujaKamthe1
 
Extractive Metallurgy Project
Extractive  Metallurgy  ProjectExtractive  Metallurgy  Project
Extractive Metallurgy ProjectAbhijeet Singh
 
Lec Smelting Of Iron
Lec  Smelting Of IronLec  Smelting Of Iron
Lec Smelting Of Ironadilshahzad2002
 
Pyrometallurgy Extraction of zinc presentation
Pyrometallurgy Extraction of zinc presentationPyrometallurgy Extraction of zinc presentation
Pyrometallurgy Extraction of zinc presentationmcdonaldhazard
 
project report bsl
project report bslproject report bsl
project report bslAKSHAY KUMAR
 
FASTMET PROCESS Minerals.pptx
FASTMET PROCESS Minerals.pptxFASTMET PROCESS Minerals.pptx
FASTMET PROCESS Minerals.pptxMELISSAMUNASHETAKUND
 
Sintering plant at a glance
Sintering plant at a glanceSintering plant at a glance
Sintering plant at a glanceSajan Agrawal
 
Puddling furnace
Puddling furnace Puddling furnace
Puddling furnace Donella Long
 
Puddling furnace
Puddling furnace Puddling furnace
Puddling furnace Donella Long
 
Steel manufacturing.ppthhh>jjjjjjjjjjjjjjj
Steel manufacturing.ppthhh>jjjjjjjjjjjjjjjSteel manufacturing.ppthhh>jjjjjjjjjjjjjjj
Steel manufacturing.ppthhh>jjjjjjjjjjjjjjjteddiyfentaw
 
Manufacturing cast iron.pptggggggvgggggy
Manufacturing cast iron.pptggggggvgggggyManufacturing cast iron.pptggggggvgggggy
Manufacturing cast iron.pptggggggvgggggyteddiyfentaw
 
Iron and Steel Making with allied chemical reactions .pptx
Iron and Steel Making with allied chemical reactions .pptxIron and Steel Making with allied chemical reactions .pptx
Iron and Steel Making with allied chemical reactions .pptx029DevendraKumarSing
 
Blast Furnace Iron Making Process with Construction and Chemical Reactions in...
Blast Furnace Iron Making Process with Construction and Chemical Reactions in...Blast Furnace Iron Making Process with Construction and Chemical Reactions in...
Blast Furnace Iron Making Process with Construction and Chemical Reactions in...029DevendraKumarSing
 
Hindustan Zinc ltd. HydroPlant Internship ppt
Hindustan Zinc ltd. HydroPlant Internship pptHindustan Zinc ltd. HydroPlant Internship ppt
Hindustan Zinc ltd. HydroPlant Internship pptManish Sharma
 
Lecture 7- Blast Furnace(BF) Products.pptx
Lecture 7- Blast Furnace(BF) Products.pptxLecture 7- Blast Furnace(BF) Products.pptx
Lecture 7- Blast Furnace(BF) Products.pptxJunaidHabib8
 
Final ppt
Final pptFinal ppt
Final pptEarl Busto
 
Metallurgical coke
Metallurgical cokeMetallurgical coke
Metallurgical cokeKhhushbakht
 

Ähnlich wie Tutorial on roasting furnaces final (20)

Extraction of zinc
Extraction of zincExtraction of zinc
Extraction of zinc
 
extraction of Fe and Cu metals from their ores , alloys
extraction of Fe and Cu metals from their ores , alloysextraction of Fe and Cu metals from their ores , alloys
extraction of Fe and Cu metals from their ores , alloys
 
Extractive Metallurgy Project
Extractive  Metallurgy  ProjectExtractive  Metallurgy  Project
Extractive Metallurgy Project
 
Lec Smelting Of Iron
Lec  Smelting Of IronLec  Smelting Of Iron
Lec Smelting Of Iron
 
Pyrometallurgy Extraction of zinc presentation
Pyrometallurgy Extraction of zinc presentationPyrometallurgy Extraction of zinc presentation
Pyrometallurgy Extraction of zinc presentation
 
project report bsl
project report bslproject report bsl
project report bsl
 
FASTMET PROCESS Minerals.pptx
FASTMET PROCESS Minerals.pptxFASTMET PROCESS Minerals.pptx
FASTMET PROCESS Minerals.pptx
 
Sintering plant at a glance
Sintering plant at a glanceSintering plant at a glance
Sintering plant at a glance
 
Puddling furnace
Puddling furnace Puddling furnace
Puddling furnace
 
Puddling furnace
Puddling furnace Puddling furnace
Puddling furnace
 
Steel manufacturing.ppthhh>jjjjjjjjjjjjjjj
Steel manufacturing.ppthhh>jjjjjjjjjjjjjjjSteel manufacturing.ppthhh>jjjjjjjjjjjjjjj
Steel manufacturing.ppthhh>jjjjjjjjjjjjjjj
 
Cupola furnace
Cupola furnaceCupola furnace
Cupola furnace
 
Manufacturing cast iron.pptggggggvgggggy
Manufacturing cast iron.pptggggggvgggggyManufacturing cast iron.pptggggggvgggggy
Manufacturing cast iron.pptggggggvgggggy
 
Iron and Steel Making with allied chemical reactions .pptx
Iron and Steel Making with allied chemical reactions .pptxIron and Steel Making with allied chemical reactions .pptx
Iron and Steel Making with allied chemical reactions .pptx
 
Chapter2 (JF302)
Chapter2 (JF302)Chapter2 (JF302)
Chapter2 (JF302)
 
Blast Furnace Iron Making Process with Construction and Chemical Reactions in...
Blast Furnace Iron Making Process with Construction and Chemical Reactions in...Blast Furnace Iron Making Process with Construction and Chemical Reactions in...
Blast Furnace Iron Making Process with Construction and Chemical Reactions in...
 
Hindustan Zinc ltd. HydroPlant Internship ppt
Hindustan Zinc ltd. HydroPlant Internship pptHindustan Zinc ltd. HydroPlant Internship ppt
Hindustan Zinc ltd. HydroPlant Internship ppt
 
Lecture 7- Blast Furnace(BF) Products.pptx
Lecture 7- Blast Furnace(BF) Products.pptxLecture 7- Blast Furnace(BF) Products.pptx
Lecture 7- Blast Furnace(BF) Products.pptx
 
Final ppt
Final pptFinal ppt
Final ppt
 
Metallurgical coke
Metallurgical cokeMetallurgical coke
Metallurgical coke
 

KĂŒrzlich hochgeladen

This PowerPoint helps students to consider the concept of infinity.
This PowerPoint helps students to consider the concept of infinity.This PowerPoint helps students to consider the concept of infinity.
This PowerPoint helps students to consider the concept of infinity.christianmathematics
 
Google Gemini An AI Revolution in Education.pptx
Google Gemini An AI Revolution in Education.pptxGoogle Gemini An AI Revolution in Education.pptx
Google Gemini An AI Revolution in Education.pptxDr. Sarita Anand
 
Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...
Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...
Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...ZurliaSoop
 
Spellings Wk 3 English CAPS CARES Please Practise
Spellings Wk 3 English CAPS CARES Please PractiseSpellings Wk 3 English CAPS CARES Please Practise
Spellings Wk 3 English CAPS CARES Please PractiseAnaAcapella
 
Understanding Accommodations and Modifications
Understanding  Accommodations and ModificationsUnderstanding  Accommodations and Modifications
Understanding Accommodations and ModificationsMJDuyan
 
General Principles of Intellectual Property: Concepts of Intellectual Proper...
General Principles of Intellectual Property: Concepts of Intellectual  Proper...General Principles of Intellectual Property: Concepts of Intellectual  Proper...
General Principles of Intellectual Property: Concepts of Intellectual Proper...Poonam Aher Patil
 
On National Teacher Day, meet the 2024-25 Kenan Fellows
On National Teacher Day, meet the 2024-25 Kenan FellowsOn National Teacher Day, meet the 2024-25 Kenan Fellows
On National Teacher Day, meet the 2024-25 Kenan FellowsMebane Rash
 
How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17Celine George
 
Food safety_Challenges food safety laboratories_.pdf
Food safety_Challenges food safety laboratories_.pdfFood safety_Challenges food safety laboratories_.pdf
Food safety_Challenges food safety laboratories_.pdfSherif Taha
 
FSB Advising Checklist - Orientation 2024
FSB Advising Checklist - Orientation 2024FSB Advising Checklist - Orientation 2024
FSB Advising Checklist - Orientation 2024Elizabeth Walsh
 
1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 -  Danh muc Sach Giao Khoa 10 . pdf1029 -  Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdfQucHHunhnh
 
Sociology 101 Demonstration of Learning Exhibit
Sociology 101 Demonstration of Learning ExhibitSociology 101 Demonstration of Learning Exhibit
Sociology 101 Demonstration of Learning Exhibitjbellavia9
 
SKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptx
SKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptxSKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptx
SKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptxAmanpreet Kaur
 
Introduction to Nonprofit Accounting: The Basics
Introduction to Nonprofit Accounting: The BasicsIntroduction to Nonprofit Accounting: The Basics
Introduction to Nonprofit Accounting: The BasicsTechSoup
 
ICT role in 21st century education and it's challenges.
ICT role in 21st century education and it's challenges.ICT role in 21st century education and it's challenges.
ICT role in 21st century education and it's challenges.MaryamAhmad92
 
Salient Features of India constitution especially power and functions
Salient Features of India constitution especially power and functionsSalient Features of India constitution especially power and functions
Salient Features of India constitution especially power and functionsKarakKing
 
Making communications land - Are they received and understood as intended? we...
Making communications land - Are they received and understood as intended? we...Making communications land - Are they received and understood as intended? we...
Making communications land - Are they received and understood as intended? we...Association for Project Management
 
SOC 101 Demonstration of Learning Presentation
SOC 101 Demonstration of Learning PresentationSOC 101 Demonstration of Learning Presentation
SOC 101 Demonstration of Learning Presentationcamerronhm
 

KĂŒrzlich hochgeladen (20)

This PowerPoint helps students to consider the concept of infinity.
This PowerPoint helps students to consider the concept of infinity.This PowerPoint helps students to consider the concept of infinity.
This PowerPoint helps students to consider the concept of infinity.
 
Google Gemini An AI Revolution in Education.pptx
Google Gemini An AI Revolution in Education.pptxGoogle Gemini An AI Revolution in Education.pptx
Google Gemini An AI Revolution in Education.pptx
 
Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...
Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...
Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...
 
Spatium Project Simulation student brief
Spatium Project Simulation student briefSpatium Project Simulation student brief
Spatium Project Simulation student brief
 
Mehran University Newsletter Vol-X, Issue-I, 2024
Mehran University Newsletter Vol-X, Issue-I, 2024Mehran University Newsletter Vol-X, Issue-I, 2024
Mehran University Newsletter Vol-X, Issue-I, 2024
 
Spellings Wk 3 English CAPS CARES Please Practise
Spellings Wk 3 English CAPS CARES Please PractiseSpellings Wk 3 English CAPS CARES Please Practise
Spellings Wk 3 English CAPS CARES Please Practise
 
Understanding Accommodations and Modifications
Understanding  Accommodations and ModificationsUnderstanding  Accommodations and Modifications
Understanding Accommodations and Modifications
 
General Principles of Intellectual Property: Concepts of Intellectual Proper...
General Principles of Intellectual Property: Concepts of Intellectual  Proper...General Principles of Intellectual Property: Concepts of Intellectual  Proper...
General Principles of Intellectual Property: Concepts of Intellectual Proper...
 
On National Teacher Day, meet the 2024-25 Kenan Fellows
On National Teacher Day, meet the 2024-25 Kenan FellowsOn National Teacher Day, meet the 2024-25 Kenan Fellows
On National Teacher Day, meet the 2024-25 Kenan Fellows
 
How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17
 
Food safety_Challenges food safety laboratories_.pdf
Food safety_Challenges food safety laboratories_.pdfFood safety_Challenges food safety laboratories_.pdf
Food safety_Challenges food safety laboratories_.pdf
 
FSB Advising Checklist - Orientation 2024
FSB Advising Checklist - Orientation 2024FSB Advising Checklist - Orientation 2024
FSB Advising Checklist - Orientation 2024
 
1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 -  Danh muc Sach Giao Khoa 10 . pdf1029 -  Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdf
 
Sociology 101 Demonstration of Learning Exhibit
Sociology 101 Demonstration of Learning ExhibitSociology 101 Demonstration of Learning Exhibit
Sociology 101 Demonstration of Learning Exhibit
 
SKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptx
SKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptxSKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptx
SKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptx
 
Introduction to Nonprofit Accounting: The Basics
Introduction to Nonprofit Accounting: The BasicsIntroduction to Nonprofit Accounting: The Basics
Introduction to Nonprofit Accounting: The Basics
 
ICT role in 21st century education and it's challenges.
ICT role in 21st century education and it's challenges.ICT role in 21st century education and it's challenges.
ICT role in 21st century education and it's challenges.
 
Salient Features of India constitution especially power and functions
Salient Features of India constitution especially power and functionsSalient Features of India constitution especially power and functions
Salient Features of India constitution especially power and functions
 
Making communications land - Are they received and understood as intended? we...
Making communications land - Are they received and understood as intended? we...Making communications land - Are they received and understood as intended? we...
Making communications land - Are they received and understood as intended? we...
 
SOC 101 Demonstration of Learning Presentation
SOC 101 Demonstration of Learning PresentationSOC 101 Demonstration of Learning Presentation
SOC 101 Demonstration of Learning Presentation
 

Tutorial on roasting furnaces final